HYDIN1 Antibody - BSA Free

Immunohistochemistry-Paraffin: HYDIN1 Antibody [NBP2-57868] - Staining of human prostate shows low expression as expected.

Immunohistochemistry-Paraffin: HYDIN1 Antibody [NBP2-57868] - Staining of human fallopian tube shows high expression.

Immunohistochemistry-Paraffin: HYDIN1 Antibody [NBP2-57868] - Staining in human fallopian tube and prostate tissues using anti-HYDIN antibody. Corresponding HYDIN RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HYDIN1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YLPGVPEVFKRSFQIQIAHLDPENITLSGEGIFPQICLDLPRNLTANEKYEMFLNQARKNTDKEYNKCEMLDHFDVITEEVPEDEPAEVSAHLQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HYDIN
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  HYDIN1 Recombinant Protein Antigen (NBP2-57868PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HYDIN1 Antibody - BSA Free

• CILD5
• HYDIN, Axonemal Central Pair Apparatus Protein
• HYDIN2
• Hydrocephalus Inducing Homolog (Mouse)
• Hydrocephalus Inducing
• Hydrocephalus-Inducing Protein Homolog
• KIAA1864
• PPP1R31
• Protein Phosphatase 1
• Protein Phosphatase 1, Regulatory Subunit 31
• Regulatory Subunit 31

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HYDIN