WDR16 Antibody

Images

 
Immunohistochemistry-Paraffin: WDR16 Antibody [NBP1-81947] - Staining of human placenta shows low expression as expected.
Immunohistochemistry-Paraffin: WDR16 Antibody [NBP1-81947] - Staining of human fallopian tube shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: WDR16 Antibody [NBP1-81947] - Staining in human fallopian tube and placenta tissues using anti-CFAP52 antibody. Corresponding CFAP52 RNA-seq data are ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

WDR16 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FYLGTTTGDILKMNPRTKLLTDVGPAKDKFSLGVSAIRCLKMGGLLVGSGAGLLVFCKSPGYKPIKKIQLQGGITSITLRGEGHQFLVGTEESH
Specificity
Specificity of human WDR16 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WDR16
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
WDR16 Protein (NBP1-81947PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WDR16 Antibody

  • WD repeat domain 16
  • WD repeat-containing protein 16
  • WD40-repeat protein upregulated in HCC
  • WD40-repeat protein up-regulated in HCC
  • WDRPUHFLJ37528

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97505
Species: Hu, Mu, Rt, Po, Bv, Ce, Ca, Dr, GP, Pl, Pm, Rb, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MAB2476
Species: Hu
Applications: WB, IHC
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67817
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-57868
Species: Hu
Applications: IHC, IHC-P
NBP2-24582
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
NBP1-30959
Species: Hu
Applications: WB
AF1924
Species: Hu
Applications: WB, Simple Western, ChIP, ICC
AF5448
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-80923
Species: Hu
Applications: WB, IHC, IHC-P

Publications for WDR16 Antibody (NBP1-81947) (0)

There are no publications for WDR16 Antibody (NBP1-81947).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDR16 Antibody (NBP1-81947) (0)

There are no reviews for WDR16 Antibody (NBP1-81947). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for WDR16 Antibody (NBP1-81947) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for WDR16 Antibody (NBP1-81947)

Discover related pathways, diseases and genes to WDR16 Antibody (NBP1-81947). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WDR16 Antibody (NBP1-81947)

Discover more about diseases related to WDR16 Antibody (NBP1-81947).
 

Pathways for WDR16 Antibody (NBP1-81947)

View related products by pathway.

Research Areas for WDR16 Antibody (NBP1-81947)

Find related products by research area.

Blogs on WDR16

There are no specific blogs for WDR16, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WDR16 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WDR16