Recombinant Human Hyaluronidase 1/HYAL1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Hyaluronidase 1/HYAL1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 253 of Human HYAL1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQCPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNLPVLPYVQIFYDTTNHFLPLDELEHSLGESAAQGAAGVVLWVSWENTRTKESCQAIKEYMDTTLGPFILNVTSGALLCSQALCSGHGRCVRRTSHPKALLLLNPASFSIQLTPGGGPLSLRGALSLEDQAQMAVEFKCRCYPGWQAPWCERKSMW

Protein/Peptide Type
Recombinant Protein
Gene
HYAL1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Hyaluronidase 1/HYAL1 Protein

  • EC 3.2.1.35
  • FUS2
  • HYAL1
  • HYAL-1
  • Hyaluronidase 1
  • Hyaluronoglucosaminidase 1
  • hyaluronoglucosaminidase-1
  • LUCA1
  • luCa-1
  • LUCA1hyaluronidase-1
  • Lung carcinoma protein 1
  • MGC45987
  • NAT6
  • plasma hyaluronidase
  • tumor suppressor LUCA-1

Background

This gene encodes a lysosomal hyaluronidase. Hyaluronidases intracellularly degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan is thought to be involved in cell proliferation, migration and differentiation. This enzyme is active at an acidic pH and is the major hyaluronidase in plasma. Mutations in this gene are associated with mucopolysaccharidosis type IX, or hyaluronidase deficiency. The gene is one of several related genes in a region of chromosome 3p21.3 associated with tumor suppression. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81283
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81637
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14112
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-51635
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-37446
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-86328
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33456
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86355
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6144
Species: Hu
Applications: WB, Simple Western
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB100-2218
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00009254-M12
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-76538
Species: Hu, Mu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF756
Species: Mu
Applications: WB, IHC
NBP1-82537
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Hyaluronidase 1/HYAL1 Recombinant Protein (H00003373-P01) (0)

There are no publications for Hyaluronidase 1/HYAL1 Recombinant Protein (H00003373-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hyaluronidase 1/HYAL1 Recombinant Protein (H00003373-P01) (0)

There are no reviews for Hyaluronidase 1/HYAL1 Recombinant Protein (H00003373-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hyaluronidase 1/HYAL1 Recombinant Protein (H00003373-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Hyaluronidase 1/HYAL1 Products

Bioinformatics Tool for Hyaluronidase 1/HYAL1 Recombinant Protein (H00003373-P01)

Discover related pathways, diseases and genes to Hyaluronidase 1/HYAL1 Recombinant Protein (H00003373-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hyaluronidase 1/HYAL1 Recombinant Protein (H00003373-P01)

Discover more about diseases related to Hyaluronidase 1/HYAL1 Recombinant Protein (H00003373-P01).
 

Pathways for Hyaluronidase 1/HYAL1 Recombinant Protein (H00003373-P01)

View related products by pathway.

PTMs for Hyaluronidase 1/HYAL1 Recombinant Protein (H00003373-P01)

Learn more about PTMs related to Hyaluronidase 1/HYAL1 Recombinant Protein (H00003373-P01).

Blogs on Hyaluronidase 1/HYAL1

There are no specific blogs for Hyaluronidase 1/HYAL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Hyaluronidase 1/HYAL1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HYAL1
Entrez