Hyaluronan synthase 1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Hyaluronan synthase 1 Antibody [NBP2-39087] - Staining of human cell line LHCN-M2 shows localization to nucleoplasm & plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Hyaluronan synthase 1 Antibody [NBP2-39087] - Staining of human skin shows moderate positivity in basement membrane of epithelial cells.
Immunohistochemistry-Paraffin: Hyaluronan synthase 1 Antibody [NBP2-39087] - Staining of human breast shows moderate membranous positivity in adipocytes.
Immunohistochemistry-Paraffin: Hyaluronan synthase 1 Antibody [NBP2-39087] - Staining of human colon shows moderate membranous positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: Hyaluronan synthase 1 Antibody [NBP2-39087] - Staining of human prostate shows strong membranous positivity in smooth muscle cells.

Product Details

Summary
Product Discontinued
View other related Hyaluronan synthase 1 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-39087
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Hyaluronan synthase 1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DGNRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPAAAGAVGAGAYREVEAEDPGRLAVEALVRTRRCVCV
Predicted Species
Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HAS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Hyaluronan synthase 1 Antibody

  • HA synthase 1
  • HAS
  • huHAS1
  • hyaluronan synthase 1
  • hyaluronate synthase 1
  • hyaluronic acid synthase 1

Background

Hyaluronan or hyaluronic acid (HA) is a high molecular weight unbranched polysaccharide synthesized by a wide varietyof organisms from bacteria to mammals, and is a constituent of the extracellular matrix. It consists of alternatingglucuronic acid and N-acetylglucosamine residues that are linked by beta-1-3 and beta-1-4 glycosidic bonds. HA issynthesized by membrane-bound synthase at the inner surface of the plasma membrane, and the chains are extrudedthrough pore-like structures into the extracellular space. It serves a variety of functions, including space filling,lubrication of joints, and provision of a matrix through which cells can migrate. HA is actively produced during woundhealing and tissue repair to provide a framework for ingrowth of blood vessels and fibroblasts. Changes in the serumconcentration of HA are associated with inflammatory and degenerative arthropathies such as rheumatoid arthritis. Inaddition, the interaction of HA with the leukocyte receptor CD44 is important in tissue-specific homing by leukocytes,and overexpression of HA receptors has been correlated with tumor metastasis. HAS1 is a member of the newly identifiedvertebrate gene family encoding putative hyaluronan synthases, and its amino acid sequence shows significant homologyto the hasA gene product of Streptococcus pyogenes, a glycosaminoglycan synthetase (DG42) from Xenopus laevis, and arecently described murine hyaluronan synthase. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37446
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-37494
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC,  IHC-P, WB
BBA10
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
NBP1-82845
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP1-81283
Species: Hu
Applications: IHC,  IHC-P
NBP1-00201
Species: Hu
Applications: Flow, ICC/IF, IHC, PEP-ELISA
NBP2-93736
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
485-MI
Species: Mu
Applications: BA
233-FB
Species: Hu
Applications: BA
H00005018-D01P
Species: Hu
Applications: ICC/IF, WB
NBP1-76538
Species: Hu, Mu, Po, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NBP1-85432
Species: Hu, Mu
Applications: COMET, IHC,  IHC-P, mIF
M6000B
Species: Mu
Applications: ELISA
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA

Publications for Hyaluronan synthase 1 Antibody (NBP2-39087) (0)

There are no publications for Hyaluronan synthase 1 Antibody (NBP2-39087).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hyaluronan synthase 1 Antibody (NBP2-39087) (0)

There are no reviews for Hyaluronan synthase 1 Antibody (NBP2-39087). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Hyaluronan synthase 1 Antibody (NBP2-39087) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Hyaluronan synthase 1 Products

Research Areas for Hyaluronan synthase 1 Antibody (NBP2-39087)

Find related products by research area.

Blogs on Hyaluronan synthase 1

There are no specific blogs for Hyaluronan synthase 1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Hyaluronan synthase 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HAS1
Uniprot