Hyaluronan synthase 1 Antibody

Immunocytochemistry/Immunofluorescence: Hyaluronan synthase 1 Antibody [NBP2-39087] - Staining of human cell line LHCN-M2 shows localization to nucleoplasm & plasma membrane. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Hyaluronan synthase 1 Antibody [NBP2-39087] - Staining of human skin shows moderate positivity in basement membrane of epithelial cells.

Immunohistochemistry-Paraffin: Hyaluronan synthase 1 Antibody [NBP2-39087] - Staining of human breast shows moderate membranous positivity in adipocytes.

Immunohistochemistry-Paraffin: Hyaluronan synthase 1 Antibody [NBP2-39087] - Staining of human colon shows moderate membranous positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: Hyaluronan synthase 1 Antibody [NBP2-39087] - Staining of human prostate shows strong membranous positivity in smooth muscle cells.

Product Discontinued

Hyaluronan synthase 1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DGNRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPAAAGAVGAGAYREVEAEDPGRLAVEALVRTRRCVCV
• Predicted Species: Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HAS1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Hyaluronan synthase 1 Antibody

• HA synthase 1
• HAS
• huHAS1
• hyaluronan synthase 1
• hyaluronate synthase 1
• hyaluronic acid synthase 1

Background

Hyaluronan or hyaluronic acid (HA) is a high molecular weight unbranched polysaccharide synthesized by a wide varietyof organisms from bacteria to mammals, and is a constituent of the extracellular matrix. It consists of alternatingglucuronic acid and N-acetylglucosamine residues that are linked by beta-1-3 and beta-1-4 glycosidic bonds. HA issynthesized by membrane-bound synthase at the inner surface of the plasma membrane, and the chains are extrudedthrough pore-like structures into the extracellular space. It serves a variety of functions, including space filling,lubrication of joints, and provision of a matrix through which cells can migrate. HA is actively produced during woundhealing and tissue repair to provide a framework for ingrowth of blood vessels and fibroblasts. Changes in the serumconcentration of HA are associated with inflammatory and degenerative arthropathies such as rheumatoid arthritis. Inaddition, the interaction of HA with the leukocyte receptor CD44 is important in tissue-specific homing by leukocytes,and overexpression of HA receptors has been correlated with tumor metastasis. HAS1 is a member of the newly identifiedvertebrate gene family encoding putative hyaluronan synthases, and its amino acid sequence shows significant homologyto the hasA gene product of Streptococcus pyogenes, a glycosaminoglycan synthetase (DG42) from Xenopus laevis, and arecently described murine hyaluronan synthase. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HAS1
• Uniprot:
  • Q92839(Human)