HYAL2 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

HYAL2 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HYAL2.
  
  

  Source: E. coli

  Amino Acid Sequence: APPIFTGRPFVVAWDVPTQDCGPRLKVPLDLNAFDVQASPNEGFVNQNITIFYRDRLGLYPRFDSAGRSVHGGVPQNVSLWAHRK

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: HYAL2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81283.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HYAL2 Recombinant Protein Antigen

• EC 3.2.1.35
• HYAL-2
• Hyaluronidase 2
• hyaluronoglucosaminidase 2
• hyaluronoglucosaminidase-2
• LUCA2
• LUCA-2
• LUCA2hyaluronidase-2
• Lung carcinoma protein 2
• lysosomal hyaluronidase
• PH20 homolog
• PH-20 homolog

Background

HYAL2 (Hyaluronoglucosaminidase 2) is involved in glycosaminoglycan catabolism. HYAL2 has been associated with tumor suppression due to its location in a region of chromosome 3p21.3. HYAL2 is known to have interactions with MST1R, ERVW-1, ARSB, CD44 and HMMR. HYAL2 has been studied in relation to several diseases and disorders including lung carcinoma, breast cancer, COPD, gastric cancer, endometrial cancer, Non-Hodgkin lymphoma, rheumatoid arthritis, Hodgkin's lymphoma and osteoarthritis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: HYAL2