HYAL2 Recombinant Protein Antigen

Images

 
There are currently no images for HYAL2 Protein (NBP1-81283PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HYAL2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HYAL2.

Source: E. coli

Amino Acid Sequence: APPIFTGRPFVVAWDVPTQDCGPRLKVPLDLNAFDVQASPNEGFVNQNITIFYRDRLGLYPRFDSAGRSVHGGVPQNVSLWAHRK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HYAL2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81283.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HYAL2 Recombinant Protein Antigen

  • EC 3.2.1.35
  • HYAL-2
  • Hyaluronidase 2
  • hyaluronoglucosaminidase 2
  • hyaluronoglucosaminidase-2
  • LUCA2
  • LUCA-2
  • LUCA2hyaluronidase-2
  • Lung carcinoma protein 2
  • lysosomal hyaluronidase
  • PH20 homolog
  • PH-20 homolog

Background

HYAL2 (Hyaluronoglucosaminidase 2) is involved in glycosaminoglycan catabolism. HYAL2 has been associated with tumor suppression due to its location in a region of chromosome 3p21.3. HYAL2 is known to have interactions with MST1R, ERVW-1, ARSB, CD44 and HMMR. HYAL2 has been studied in relation to several diseases and disorders including lung carcinoma, breast cancer, COPD, gastric cancer, endometrial cancer, Non-Hodgkin lymphoma, rheumatoid arthritis, Hodgkin's lymphoma and osteoarthritis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-93736
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-83409
Species: Hu
Applications: IHC,  IHC-P
NBP1-51635
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-37446
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-46063
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
BBA10
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
NBP2-47579
Species: Hu
Applications: IB, ICC/IF, IHC,  IHC-P, WB
NBP2-37494
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-24653
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-03644
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
NBP1-89062
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-76538
Species: Hu, Mu, Po, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-82537
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for HYAL2 Protein (NBP1-81283PEP) (0)

There are no publications for HYAL2 Protein (NBP1-81283PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HYAL2 Protein (NBP1-81283PEP) (0)

There are no reviews for HYAL2 Protein (NBP1-81283PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HYAL2 Protein (NBP1-81283PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HYAL2 Products

Research Areas for HYAL2 Protein (NBP1-81283PEP)

Find related products by research area.

Blogs on HYAL2

There are no specific blogs for HYAL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HYAL2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HYAL2