HSPC132 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HSPC132 Antibody [NBP2-30707] - Staining of human cell line MCF-7 shows positivity in nucleus but not nucleoli and mitochondria. Antibody staining is shown in green.
Immunohistochemistry: HSPC132 Antibody [NBP2-30707] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HSPC132 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLEFMGHGKE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HSPC132 Protein (NBP2-30707PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HSPC132 Antibody

  • 15E1.1
  • MDM35
  • MDM-35
  • Mitochondrial Distribution And Morphology 35 Homolog
  • P53CSV
  • P53-Inducible Cell-Survival Factor
  • Protein 15E1.1
  • TP53 regulated inhibitor of apoptosis 1
  • TP53-Regulated Inhibitor Of Apoptosis
  • TRIAP1
  • WF-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-00153
Species: Hu, Rt, Bv
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-56074
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-59357
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32530
Species: Hu
Applications: WB, IHC, IHC-P
AF5617
Species: Hu
Applications: WB
NB100-64980
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-74480
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
H00079026-M01
Species: Hu
Applications: WB, ELISA, IP
NBP1-85931
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-351
Species: Hu, Mu
Applications: WB, IHC-P, IP
H00009261-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, PLA
H00028996-M03
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-84420
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00637
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-77332
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF

Publications for HSPC132 Antibody (NBP2-30707) (0)

There are no publications for HSPC132 Antibody (NBP2-30707).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSPC132 Antibody (NBP2-30707) (0)

There are no reviews for HSPC132 Antibody (NBP2-30707). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HSPC132 Antibody (NBP2-30707) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HSPC132 Products

HSPC132 NBP2-30707

Bioinformatics Tool for HSPC132 Antibody (NBP2-30707)

Discover related pathways, diseases and genes to HSPC132 Antibody (NBP2-30707). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSPC132 Antibody (NBP2-30707)

Discover more about diseases related to HSPC132 Antibody (NBP2-30707).
 

Pathways for HSPC132 Antibody (NBP2-30707)

View related products by pathway.

Blogs on HSPC132

There are no specific blogs for HSPC132, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HSPC132 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIAP1
Uniprot