HspBP1 Antibody - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse HspBP1 Antibody - Azide and BSA Free (H00023640-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
HSPBP1 (NP_036399.3, 1 a.a. - 359 a.a.) full-length human protein. MSDEGSRGSRLPLALPPASQGCSSGGGGGGSSAGGSGNSRPPRNLQGLLQMAITAGSEEPDPPPEPMSEERRQWLQEAMSAAFRGQREEVEQMKSCLRVLSQPMPPTAGEAEQAADQQEREGALELLADLCENMDNAADFCQLSGMHLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQEQVLGLGALRKLLRLLDRDACDTVRVKALFAISCLVREQEAGLLQFLRLDGFSVLMRAMQQQVQKLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQLVALVRTEHSPFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFCEKLLQTCFSSPADDSMDR |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
HSPBP1 |
| Purity |
Protein G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This antibody is useful for Western Blot, Functional |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for HspBP1 Antibody - Azide and BSA Free
Background
Heat shock protein binding protein is an Hsp70-interacting protein that was first isolated from a human heart cDNA library using the yeast two-hybrid system. HspBP1 binds the ATPase domain of Hsp70, and inhibits Hsp70 chaperone activity. More recently HspBP1 was found to promote nucleotide dissociation from Hsc70 and is capable of altering the confirmation of the Hsp70 ATPase domain. HspBP1 is capable of regulating any Hsp70 activity that requires ATPase.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Ca, Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Ch, Pm, Hu, Pm, Mu, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Ca, Ch, Gp, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt, Sh, Xp
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Publications for HspBP1 Antibody (H00023640-B01P) (0)
There are no publications for HspBP1 Antibody (H00023640-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HspBP1 Antibody (H00023640-B01P) (0)
There are no reviews for HspBP1 Antibody (H00023640-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for HspBP1 Antibody (H00023640-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional HspBP1 Products
Research Areas for HspBP1 Antibody (H00023640-B01P)
Find related products by research area.
|
Blogs on HspBP1