HSF1 Antibody (1A11)

Images

 
Immunocytochemistry/ Immunofluorescence: HSF1 Antibody (1A11) [H00003297-M09] - Analysis of monoclonal antibody to HSF1 on HeLa cell. Antibody concentration 20 ug/ml
Sandwich ELISA: HSF1 Antibody (1A11) [H00003297-M09] - Detection limit for recombinant GST tagged HSF1 is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1A11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HSF1 Antibody (1A11) Summary

Immunogen
HSF1 (NP_005517.1 256 a.a. - 359 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DAVASSGPIISDITELAPASPMASPGGSIDERPLSSSPLVRVKEEPPSPPQSPRVEEASPGRPSSVDTLLSPTALIDSILRESEPAPASVTALTDARGHTDTEG
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HSF1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HSF1 Antibody (1A11)

  • heat shock factor protein 1
  • heat shock transcription factor 1HSTF1HSF 1
  • HSF1
  • HSTF 1
  • HSTF1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-02459
Species: Hu, Mu, Rt, Ch, Dr, Pm
Applications: WB, ELISA, IHC, IHC-P
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF5227
Species: Hu, Mu
Applications: WB
H00008630-P01
Species: Hu
NB120-2788
Species: Hu, Mu, Rt, Bv, Fe, Fi, Ha, Pm
Applications: WB, B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-03433
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
MAB5695
Species: Hu, Mu
Applications: WB
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB200-603
Species: Hu, Mu, Xp
Applications: WB, IHC, IHC-Fr, IHC-P, IP, IF
H00003297-M09
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for HSF1 Antibody (H00003297-M09) (0)

There are no publications for HSF1 Antibody (H00003297-M09).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSF1 Antibody (H00003297-M09) (0)

There are no reviews for HSF1 Antibody (H00003297-M09). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HSF1 Antibody (H00003297-M09) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HSF1 Products

Bioinformatics Tool for HSF1 Antibody (H00003297-M09)

Discover related pathways, diseases and genes to HSF1 Antibody (H00003297-M09). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSF1 Antibody (H00003297-M09)

Discover more about diseases related to HSF1 Antibody (H00003297-M09).
 

Pathways for HSF1 Antibody (H00003297-M09)

View related products by pathway.

PTMs for HSF1 Antibody (H00003297-M09)

Learn more about PTMs related to HSF1 Antibody (H00003297-M09).
 

Research Areas for HSF1 Antibody (H00003297-M09)

Find related products by research area.

Blogs on HSF1

There are no specific blogs for HSF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HSF1 Antibody (1A11) and receive a gift card or discount.

Bioinformatics

Gene Symbol HSF1
Entrez
Uniprot