HSD17B8 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

HSD17B8 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HSD17B8.
  
  

  Source: E. coli

  Amino Acid Sequence: GQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGY

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: HSD17B8
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84309.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HSD17B8 Recombinant Protein Antigen

• D6S2245EdJ1033B10.9
• EC 1.1.1.-
• EC 1.1.1.62
• EC 1.1.1.63,17-beta-HSD 8
• estrogen 17-oxidoreductase
• FABGLestradiol 17-beta-dehydrogenase 8
• H2-KE6
• HKE6FabG (beta-ketoacyl-[acyl-carrier-protein] reductase, E coli) like (E. coli)
• hydroxysteroid (17-beta) dehydrogenase 8,3-oxoacyl-[acyl-carrier-protein] reductase
• KE6
• ke-6
• Ke-6,17-beta-hydroxysteroid dehydrogenase 8
• Protein Ke6
• Really interesting new gene 2 protein
• RING2FABG
• SDR30C1
• short chain dehydrogenase/reductase family 30C, member 1
• Testosterone 17-beta-dehydrogenase 8

Background

In mice, the Ke6 protein is a 17-beta-hydroxysteroid dehydrogenase that can regulate the concentration of biologically active estrogens and androgens. It is preferentially an oxidative enzyme and inactivates estradiol, testosterone, and dihydrotestosterone. However, the enzyme has some reductive activity and can synthesize estradiol from estrone. The protein encoded by this gene is similar to Ke6 and is a member of the short-chain dehydrogenase superfamily. An alternatively spliced transcript of this gene has been detected, but the full-length nature of this variant has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: HSD17B8