HSD17B6 Antibody

Western Blot: HSD17B6 Antibody [H00008630-B01P] - Analysis of HSD17B6 expression in human liver.

Western Blot: HSD17B6 Antibody [H00008630-B01P] - Analysis of HSD17B6 expression in transfected 293T cell line by HSD17B6 polyclonal antibody. Lane 1: HSD17B6 transfected lysate(34.87 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

HSD17B6 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: HSD17B6 (NP_003716.2, 1 a.a. - 317 a.a.) full-length human protein. MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLDARGLRVLAACLTEKGAEQLRGQTSDRLETVTLDVTKMESIAAATQWVKEHVGDRGLWGLVNNAGILTPITLCEWLNTEDSMNMLKVNLIGVIQVTLSMLPLVRRARGRIVNVSSILGRVAFFVGGYCVSKYGVEAFSDILRREIQHFGVKISIVEPGYFRTGMTNMTQSLERMKQSWKEAPKHIKETYGQQYFDALYNIMKEGLLNCSTNLNLVTDCMEHALTSVHPRTRYSAGWDAKFFFIPLSYLPTSLADYILTRSWPKPAQAV
• Specificity: HSD17B6 - hydroxysteroid (17-beta) dehydrogenase 6 homolog (mouse),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: HSD17B6
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. Use in Immunohistochemistry-paraffin reported in scientific literature (Muthusamy S. et al).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HSD17B6 Antibody

• 17-beta-HSD 6
• 17-beta-HSD6
• 17-beta-hydroxysteroid dehydrogenase type 6
• 3(alpha->beta)-hydroxysteroid epimerase
• 3-alpha->beta-HSE
• EC 1.1.1
• EC 1.1.1.105
• EC 1.1.1.62
• EC 1.1.1.63
• HSE3-hydroxysteroid epimerase
• hydroxysteroid (17-beta) dehydrogenase 6 homolog (mouse)
• hydroxysteroid (17-beta) dehydrogenase 6
• NAD+ -dependent 3 alpha-hydroxysteroid dehydrogenase 3-hydroxysteroid epimerase
• Oxidative 3-alpha hydroxysteroid dehydrogenase
• oxidative 3-alpha-hydroxysteroid-dehydrogenase
• oxidoreductase
• retinol dehydrogenase
• RODH3(alpha->beta)-hydroxysteroid epimerasel
• SDR9C6
• short chain dehydrogenase/reductase family 9C, member 6,3-alpha->beta-hydroxysteroid epimerase

Background

The protein encoded by this gene has both oxidoreductase and epimerase activities and is involved in androgen catabolism. The oxidoreductase activity can convert 3 alpha-adiol to dihydrotestosterone, while the epimerase activity can convert androsterone to epi-androsterone. Both reactions use NAD+ as the preferred cofactor. This gene is a member of the retinol dehydrogenase family. Transcript variants utilizing alternative polyadenylation signals exist. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HSD17B6 Antibody (H00008630-B01P)(2)

Publications using H00008630-B01P

• Muthusamy S. Ligands of Estrogen Receptor beta in Prostate and Brain Thesis. 2014-01-01 (IHC-P, Human)
• Muthusamy S, Andersson S, Kim H-J et al. Estrogen receptor [beta] and 17[beta]-hydroxysteroid dehydrogenase type 6, a growth regulatory pathway that is lost in prostate cancer. Proc Natl Acad Sci U S A 2011-12-13 [PMID: 22114194]

Bioinformatics

• Gene Symbol: HSD17B6
• Entrez:
  • 8630(Human)
• Uniprot:
  • NP_003716.2(Human)