HS3ST6 Antibody - BSA Free

Western Blot: HS3ST6 Antibody [NBP1-91324] - Host: Rabbit. Target: HS3ST6. Positive control (+): Human Placenta (PL). Negative control (-): NTERA-2 Cell Lysate (N27). Antibody concentration: 1ug/ml

Western Blot: HS3ST6 Antibody [NBP1-91324] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Discontinued

HS3ST6 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the C terminal of human HS3ST6. Peptide sequence GERLVSDPAGEVGRVQDFLGLKRVVTDKHFYFNATKGFPCLKKAQGGSRP. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HS3ST6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for HS3ST6 Antibody - BSA Free

• h3-OST-6
• heparan sulfate (glucosamine) 3-O-sulfotransferase 6
• heparan sulfate 3-O-sulfotransferase 6
• heparan sulfate glucosamine 3-O-sulfotransferase 6
• HS3ST5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HS3ST6
• Uniprot:
  • NP_001009606(Human)