HS3ST2 Antibody

Images

 
Western Blot: HS3ST2 Antibody [NBP1-89374] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunocytochemistry/ Immunofluorescence: HS3ST2 Antibody [NBP1-89374] - Staining of human cell line U-251MG shows positivity in nucleus, nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: HS3ST2 Antibody [NBP1-89374] - Staining of human duodenum shows distinct positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HS3ST2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:APRCLRGPSAGGQKLLQKSRPCDPSGPTPSEPSAPSAPAAAVPAPRLSGSNHSGSPKLGTKRLPQALIVGVKKGGTRAVLEFIRVHPDVRALGTEPHFFDRNYGRG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HS3ST2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HS3ST2 Protein (NBP1-89374PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HS3ST2 Antibody

  • EC 2.8.2
  • EC 2.8.2.29,3-OST-2
  • h3-OST-2
  • heparan sulfate (glucosamine) 3-O-sulfotransferase 2,30ST2,3OST2heparan sulfate glucosamine 3-O-sulfotransferase 2
  • Heparan sulfate 3-O-sulfotransferase 2
  • Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 2
  • heparin-glucosamine 3-O-sulfotransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF5968
Species: Hu
Applications: WB, IP
NBP1-07100
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-30083
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
MAB3765
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
AF6085
Species: Hu, Mu
Applications: WB, IHC, Neut
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49661
Species: Hu
Applications: WB, IHC
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-92162
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00055743-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-89374
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HS3ST2 Antibody (NBP1-89374) (0)

There are no publications for HS3ST2 Antibody (NBP1-89374).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HS3ST2 Antibody (NBP1-89374) (0)

There are no reviews for HS3ST2 Antibody (NBP1-89374). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HS3ST2 Antibody (NBP1-89374) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HS3ST2 Products

Bioinformatics Tool for HS3ST2 Antibody (NBP1-89374)

Discover related pathways, diseases and genes to HS3ST2 Antibody (NBP1-89374). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HS3ST2 Antibody (NBP1-89374)

Discover more about diseases related to HS3ST2 Antibody (NBP1-89374).
 

Pathways for HS3ST2 Antibody (NBP1-89374)

View related products by pathway.

PTMs for HS3ST2 Antibody (NBP1-89374)

Learn more about PTMs related to HS3ST2 Antibody (NBP1-89374).

Blogs on HS3ST2

There are no specific blogs for HS3ST2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HS3ST2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HS3ST2