HR6B/UBE2B Antibody (4C3)

Images

 
Western Blot: HR6B/UBE2B Antibody (4C3) [H00007320-M06] - Analysis of UBE2B expression in transfected 293T cell line by UBE2B monoclonal antibody (M06), clone 4C3. Lane 1: UBE2B transfected lysatE (17.3 KDa). Lane 2: ...read more
Sandwich ELISA: HR6B/UBE2B Antibody (4C3) [H00007320-M06] - Detection limit for recombinant GST tagged UBE2B is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4C3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HR6B/UBE2B Antibody (4C3) Summary

Immunogen
UBE2B (NP_003328.1 63 a.a. - 152 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSWNDS
Specificity
UBE2B - ubiquitin-conjugating enzyme E2B (RAD6 homolog) (4C3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
UBE2B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HR6B/UBE2B Antibody (4C3)

  • E2 protein
  • E2-17k
  • E2-17kDa
  • HHR6B
  • HR6B
  • RAD6 homolog B
  • RAD6BEC 6.3.2.19
  • UBC2
  • UBE2B
  • Ubiquitin carrier protein B
  • ubiquitin-conjugating enzyme E2 B
  • Ubiquitin-conjugating enzyme E2-17 kDa
  • ubiquitin-conjugating enzyme E2B (RAD6 homolog)
  • Ubiquitin-protein ligase B

Background

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for post-replicative DNA damage repair. Its protein sequence is 100% identical to the mouse, rat, and rabbit homologs, which indicates that this enzyme is highly conserved in eukaryotic evolution. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NB100-553
Species: Hu, Mu
Applications: WB, IHC-P
NB100-65805
Species: Hu, Gt, Pm, Sh
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-89640
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56487
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IP
NB500-168
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-46270
Species: Hu
Applications: WB, IHC
H00056852-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00007320-M06
Species: Hu
Applications: WB, ELISA

Publications for HR6B/UBE2B Antibody (H00007320-M06) (0)

There are no publications for HR6B/UBE2B Antibody (H00007320-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HR6B/UBE2B Antibody (H00007320-M06) (0)

There are no reviews for HR6B/UBE2B Antibody (H00007320-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HR6B/UBE2B Antibody (H00007320-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HR6B/UBE2B Products

Bioinformatics Tool for HR6B/UBE2B Antibody (H00007320-M06)

Discover related pathways, diseases and genes to HR6B/UBE2B Antibody (H00007320-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HR6B/UBE2B Antibody (H00007320-M06)

Discover more about diseases related to HR6B/UBE2B Antibody (H00007320-M06).
 

Pathways for HR6B/UBE2B Antibody (H00007320-M06)

View related products by pathway.

PTMs for HR6B/UBE2B Antibody (H00007320-M06)

Learn more about PTMs related to HR6B/UBE2B Antibody (H00007320-M06).

Blogs on HR6B/UBE2B

There are no specific blogs for HR6B/UBE2B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HR6B/UBE2B Antibody (4C3) and receive a gift card or discount.

Bioinformatics

Gene Symbol UBE2B
Entrez
Uniprot