HPS5 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: HPS5 Antibody [NBP3-17593] - Staining of human cell line RH-30 shows localization to cytosol.

Immunohistochemistry-Paraffin: HPS5 Antibody [NBP3-17593] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HPS5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HPS5 Antibody - BSA Free (NBP3-17593) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NEESVDKTACECVRSPRESLDDLFQICSPCAIASGLRNDLAELTTLCLELNVLNSKIKSTSGHVDHTLQQYSPEIL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HPS5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, PFA/Triton X-100 is recommended for fixation/permeabilization.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HPS5 Antibody - BSA Free

• AIBP63
• alpha integrin binding protein 63
• Alpha-integrin-binding protein 63
• Hermansky-Pudlak syndrome 5
• KIAA1017Hermansky-Pudlak syndrome 5 protein
• Ru2
• Ruby-eye protein 2 homolog

Background

HPS5 encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. This protein interacts with Hermansky-Pudlak syndrome 6 protein and may interact with the cytoplasmic domain of integrin, alpha-3. Mutations in this gene are associated with Hermansky-Pudlak syndrome type 5. Multiple transcript variants encoding two distinct isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HPS5