HPRG Recombinant Protein Antigen

Images

 
There are currently no images for HPRG Protein (NBP2-33594PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HPRG Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HRG.

Source: E. coli

Amino Acid Sequence: HSHESQDLRVIDFNCTTSSVSSALANTKDSPVLIDFFEDTERYRKQANKALEKYKEENDDFASFRVDRIERVARVRGG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HRG
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33594.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HPRG Recombinant Protein Antigen

  • DKFZp779H1622
  • Histidine-proline-rich glycoprotein
  • histidine-rich glycoprotein
  • HPRG
  • HPRGHRGP
  • HRG

Background

HRG, also known as Histidine-rich glycoprotein, is a 525 amino acid protein that is approx. 60 kDa, functions as plasma glycoprotein that binds a number of ligands such as heme, heparin, heparan sulfate, thrombospondin, plasminogen, and divalent metal ions; acts as an adapter protein; mediates clearance of necrotic cells; inhibits the formation of insoluble immune complexes; ties plasminogen to the cell surface; binds T-cells and alters the cell morphology; modulates angiogenesis; inhibits endothelial cell motility; plays a role in the regulation of tumor angiogenesis and tumor immune surveillance; and normalizes tumor vessels and promotes antitumor immunity by polarizing tumor-associated macrophages. Studies on this protein have shown a relationship with thrombophilia, thrombophilia due to elevated hrg, thrombophilia due to hrg deficiency, protein c deficiency, myocardial infarction, acute myocardial infarction, corneal neovascularization, thrombosis, rheumatoid arthritis, hyperhomocysteinemia, arthritis, retinal vein occlusion, graft versus host disease, nephrotic syndrome, diabetes mellitus, cd3, twinning, retinitis, and hepatitis b. This protein has been shown to have interactions with C1QB, FGA, C1QA, FCGR1A, PLG, and THBS1 in the hemostasis, platelet degranulation, dissolution of fibrin clot, platelet activation, signaling and aggregation, and response to elevated platelet cytosolic Ca2+ pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF226
Species: Hu
Applications: WB
1129-ER
Species: Hu
Applications: BA
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
MAB3481
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, Neut
236-EG
Species: Hu
Applications: BA
MAB1131
Species: Hu
Applications: ICC, IHC, WB
AF1267
Species: Hu
Applications: IP, Neut, WB
DTSP10
Species: Hu
Applications: ELISA
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
DTPA00
Species: Hu
Applications: ELISA
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP2-33594PEP
Species: Hu
Applications: AC

Publications for HPRG Protein (NBP2-33594PEP) (0)

There are no publications for HPRG Protein (NBP2-33594PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HPRG Protein (NBP2-33594PEP) (0)

There are no reviews for HPRG Protein (NBP2-33594PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HPRG Protein (NBP2-33594PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HPRG Products

Blogs on HPRG

There are no specific blogs for HPRG, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HPRG Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HRG