HPRG Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HRG. Source: E. coli
Amino Acid Sequence: HSHESQDLRVIDFNCTTSSVSSALANTKDSPVLIDFFEDTERYRKQANKALEKYKEENDDFASFRVDRIERVARVRGG Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
HRG |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33594. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for HPRG Recombinant Protein Antigen
Background
HRG, also known as Histidine-rich glycoprotein, is a 525 amino acid protein that is approx. 60 kDa, functions as plasma glycoprotein that binds a number of ligands such as heme, heparin, heparan sulfate, thrombospondin, plasminogen, and divalent metal ions; acts as an adapter protein; mediates clearance of necrotic cells; inhibits the formation of insoluble immune complexes; ties plasminogen to the cell surface; binds T-cells and alters the cell morphology; modulates angiogenesis; inhibits endothelial cell motility; plays a role in the regulation of tumor angiogenesis and tumor immune surveillance; and normalizes tumor vessels and promotes antitumor immunity by polarizing tumor-associated macrophages. Studies on this protein have shown a relationship with thrombophilia, thrombophilia due to elevated hrg, thrombophilia due to hrg deficiency, protein c deficiency, myocardial infarction, acute myocardial infarction, corneal neovascularization, thrombosis, rheumatoid arthritis, hyperhomocysteinemia, arthritis, retinal vein occlusion, graft versus host disease, nephrotic syndrome, diabetes mellitus, cd3, twinning, retinitis, and hepatitis b. This protein has been shown to have interactions with C1QB, FGA, C1QA, FCGR1A, PLG, and THBS1 in the hemostasis, platelet degranulation, dissolution of fibrin clot, platelet activation, signaling and aggregation, and response to elevated platelet cytosolic Ca2+ pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: ELISA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, Neut
Species: Hu
Applications: BA
Species: Hu
Applications: ICC, IHC, WB
Species: Hu
Applications: IP, Neut, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
Species: Hu
Applications: AC
Publications for HPRG Protein (NBP2-33594PEP) (0)
There are no publications for HPRG Protein (NBP2-33594PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HPRG Protein (NBP2-33594PEP) (0)
There are no reviews for HPRG Protein (NBP2-33594PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for HPRG Protein (NBP2-33594PEP) (0)
Additional HPRG Products
Blogs on HPRG