HOXD10 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HOXD10 Antibody [NBP2-57634] - Staining of human cell line HEK 293 shows localization to nucleoplasm, cytosol & cytoplasmic bodies.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HOXD10 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AKREVNHQNMGMNVHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTTNIKEESNCCMYSDKRNKLISAEVPSYQRLVPESCPVENP
Specificity
Specificity of human HOXD10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HOXD10
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HOXD10 Recombinant Protein Antigen (NBP2-57634PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for HOXD10 Antibody

  • homeo box 4D
  • homeo box D10
  • homeobox D10
  • Homeobox protein Hox-4D
  • Homeobox protein Hox-4E
  • homeobox protein Hox-D10
  • HOX4
  • Hox-4.4
  • HOX4D
  • HOX4DHOX4
  • HOX4E
  • HOXD10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49631
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-85076
Species: Hu
Applications: WB
NBP1-52149
Species: Hu
Applications: ICC/IF, IHC, IHC-P, MiAr, PEP-ELISA
H00003237-M10
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP3-06103
Species: Hu
Applications: IHC, IHC-P
NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC, KD
NBP1-80228
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-85074
Species: Hu
Applications: WB, IHC, IHC-P
H00003224-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, S-ELISA
NBP2-32356
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003221-M01
Species: Hu
Applications: WB, ELISA, RNAi, S-ELISA
H00003222-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, S-ELISA
NBP2-23804
Species: Hu, Mu, Rt, Bv, Ca, Pm, Sh
Applications: PEP-ELISA
NBP2-87596
Species: Hu
Applications: WB, IHC, IHC-P
NBP3-04717
Species: Hu, Mu, Rt
Applications: WB
H00003204-M01
Species: Hu
Applications: WB, ELISA, S-ELISA
H00003229-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-83234
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-27108
Species: Hu, Mu, Pm
Applications: WB
NBP2-57634
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for HOXD10 Antibody (NBP2-57634) (0)

There are no publications for HOXD10 Antibody (NBP2-57634).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXD10 Antibody (NBP2-57634) (0)

There are no reviews for HOXD10 Antibody (NBP2-57634). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HOXD10 Antibody (NBP2-57634) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HOXD10 Products

Bioinformatics Tool for HOXD10 Antibody (NBP2-57634)

Discover related pathways, diseases and genes to HOXD10 Antibody (NBP2-57634). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXD10 Antibody (NBP2-57634)

Discover more about diseases related to HOXD10 Antibody (NBP2-57634).
 

Pathways for HOXD10 Antibody (NBP2-57634)

View related products by pathway.

PTMs for HOXD10 Antibody (NBP2-57634)

Learn more about PTMs related to HOXD10 Antibody (NBP2-57634).

Blogs on HOXD10

There are no specific blogs for HOXD10, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXD10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXD10