HOXD10 Antibody (5H5S6)

Western Blot: HOXD10 Antibody (5H5S6) [NBP3-33466] - Western blot analysis of lysates from Mouse kidney, using HOXD10 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.

• Reactivity: Mu
• Applications: WB, ELISA
• Clone: 5H5S6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

HOXD10 Antibody (5H5S6) Summary

• Description: Novus Biologicals Rabbit HOXD10 Antibody (5H5S6) (NBP3-33466) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant Protein corresponding to a sequence within amino acids 1-150 of human HOXD10 (NP_002139.2).
  
  Sequence:
  MSFPNSSPAANTFLVDSLISACRSDSFYSSSASMYMPPPSADMGTYGMQTCGLLPSLAKREVNHQNMGMNVHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTTNIKEESNCCMYSDKRNKLISAEVPSYQRLVPESCPVENPEVPVPG
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: HOXD10
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 38 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for HOXD10 Antibody (5H5S6)

• homeo box 4D
• homeo box D10
• homeobox D10
• Homeobox protein Hox-4D
• Homeobox protein Hox-4E
• homeobox protein Hox-D10
• HOX4
• Hox-4.4
• HOX4D
• HOX4DHOX4
• HOX4E
• HOXD10

Background

HOXD10 is a member of the Abd-B homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox D genes located on chromosome 2. The encoded nuclear protein functions as a sequence-specific transcription factor that is expressed in the developing limb buds and is involved in differentiation and limb development. Mutations in this gene have been associated with Wilm's tumor and congenital vertical talus (also known as rocker-bottom foot deformity or congenital convex pes valgus) and/or a foot deformity resembling that seen in Charcot-Marie-Tooth disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HOXD10