HOXD1 Antibody

Images

 
Western Blot: HOXD1 Antibody [NBP2-58710] - Western blot analysis in human cell line RT-4, human cell line U-251 MG and human plasma.
Immunocytochemistry/ Immunofluorescence: HOXD1 Antibody [NBP2-58710] - Staining of human cell line RT4 shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HOXD1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: REREGLLATAIPVAPLQLPLSGTTPTKFIKNPGSPSQSQEPS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HOXD1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HOXD1 Recombinant Protein Antigen (NBP2-58710PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for HOXD1 Antibody

  • homeo box 4G
  • homeo box D1
  • homeobox D1
  • homeobox protein Hox-D1
  • Homeobox protein Hox-GG
  • HOX4
  • HOX4GHox-4.7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46001
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00003223-M04
Species: Hu
Applications: ELISA, WB
NBP2-87596
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-83234
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45744
Species: Hu, Mu, Rt
Applications: IHC, WB
AF5014
Species: Hu
Applications: ICC, WB
NBP2-56195
Species: Hu
Applications: ICC/IF, WB
H00003222-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, S-ELISA, WB
NBP1-52085
Species: Hu, Mu
Applications: PEP-ELISA, WB
NBP3-17383
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6318
Species: Hu
Applications: ICC
NBP2-85076
Species: Hu
Applications: WB
NBP2-32515
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00003204-M01
Species: Hu
Applications: ELISA, S-ELISA, WB
NBP3-06103
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP2-75091
Species: Hu, Rt
Applications: ICC/IF, IHC-P, PEP-ELISA, WB
H00003217-M03
Species: Hu, Rb
Applications: ELISA, Func, IHC, IHC-P, WB
H00003228-M01
Species: Hu, Mu, Rt
Applications: ELISA, S-ELISA, WB
H00003229-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP1-83236
Species: Hu
Applications: IHC, IHC-P, WB

Publications for HOXD1 Antibody (NBP2-58710) (0)

There are no publications for HOXD1 Antibody (NBP2-58710).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXD1 Antibody (NBP2-58710) (0)

There are no reviews for HOXD1 Antibody (NBP2-58710). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HOXD1 Antibody (NBP2-58710) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HOXD1 Products

Bioinformatics Tool for HOXD1 Antibody (NBP2-58710)

Discover related pathways, diseases and genes to HOXD1 Antibody (NBP2-58710). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXD1 Antibody (NBP2-58710)

Discover more about diseases related to HOXD1 Antibody (NBP2-58710).
 

Pathways for HOXD1 Antibody (NBP2-58710)

View related products by pathway.

PTMs for HOXD1 Antibody (NBP2-58710)

Learn more about PTMs related to HOXD1 Antibody (NBP2-58710).

Blogs on HOXD1

There are no specific blogs for HOXD1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXD1