HOXA7 Antibody

Images

 
Western Blot: HOXA7 Antibody [NBP2-87589] - WB Suggested Anti-HOXA7 Antibody Titration: 0.2-1 ug/ml. Positive Control: Jurkat cell lysateHOXA7 is supported by BioGPS gene expression data to be expressed in Jurkat

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, Ca, Eq, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HOXA7 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human HOXA7. Peptide sequence: MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGAGAGAFAST The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Porcine (100%), Rabbit (100%), Bovine (100%), Canine (100%), Equine (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
HOXA7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HOXA7 Antibody

  • ANTP
  • homeo box A7
  • homeobox A7
  • Homeobox protein Hox 1.1
  • Homeobox protein Hox-1A
  • homeobox protein Hox-A7
  • HOX1.1
  • HOX1AHOX1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32356
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC, IHC-P
46420002
Species: Hu
Applications: WB, ELISA
NBP2-24597
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, IHC, IHC-P
NBP3-04877
Species: Hu, Mu, Rt
Applications: WB
NBP2-42520
Species: Hu, Po
Applications: WB, IHC-P, PEP-ELISA
AF1107
Species: Mu
Applications: WB, IHC
NBP1-52085
Species: Hu, Mu
Applications: WB, PEP-ELISA
H00003347-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-14098
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-23804
Species: Hu, Mu, Rt, Bv, Ca, Pm, Sh
Applications: PEP-ELISA
NBP2-24561
Species: Hu, Mu, Rt, Bv, Fe, Pm
Applications: WB, IHC, IHC-P
NBP2-27108
Species: Hu, Mu, Pm
Applications: WB
NBP2-29421
Species: Hu, Rt, Po, Bv, Gt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-49536
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-32515
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1556
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-87589
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Rb
Applications: WB

Publications for HOXA7 Antibody (NBP2-87589) (0)

There are no publications for HOXA7 Antibody (NBP2-87589).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXA7 Antibody (NBP2-87589) (0)

There are no reviews for HOXA7 Antibody (NBP2-87589). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXA7 Antibody (NBP2-87589) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HOXA7 Products

Bioinformatics Tool for HOXA7 Antibody (NBP2-87589)

Discover related pathways, diseases and genes to HOXA7 Antibody (NBP2-87589). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXA7 Antibody (NBP2-87589)

Discover more about diseases related to HOXA7 Antibody (NBP2-87589).
 

Pathways for HOXA7 Antibody (NBP2-87589)

View related products by pathway.

PTMs for HOXA7 Antibody (NBP2-87589)

Learn more about PTMs related to HOXA7 Antibody (NBP2-87589).

Blogs on HOXA7

There are no specific blogs for HOXA7, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXA7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXA7