HOXA6 Antibody

Images

 
Western Blot: HOXA6 Antibody [NBP1-98346] - Titration: 1.0 ug/ml Positive Control: Mouse Heart.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HOXA6 Antibody Summary

Immunogen
The immunogen for this antibody is Hoxa6 - N-terminal region. Peptide sequence SSYFVNPTFPGSLPSGQDSFLGQLPLYPAGYDALRPFPASYGASSLPDKT. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HOXA6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HOXA6 Antibody

  • homeo box A6
  • homeobox A6
  • Homeobox protein Hox-1B
  • homeobox protein HOXA6
  • homeobox protein Hox-A6
  • HOX1
  • HOX1.2
  • HOX1Bhomeo box 1B

Background

Hoxa6 sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82991
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP2-42520
Species: Hu, Po
Applications: IHC-P, PEP-ELISA, WB
NBP2-32356
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00003204-M01
Species: Hu
Applications: ELISA, S-ELISA, WB
NBP2-46001
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00003231-M01
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
NBP2-32515
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-06103
Species: Hu
Applications: Flow, IHC, IHC-P, WB
H00003213-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-85076
Species: Hu
Applications: WB
NBP2-27108
Species: Hu, Mu, Pm
Applications: WB
H00003232-M09
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
H00003237-M10
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-45744
Species: Hu, Mu, Rt
Applications: IHC, WB
1845-SH/CF
Species: Hu
Applications: BA
H00003223-M04
Species: Hu
Applications: ELISA, WB
NBP2-24561
Species: Bv, Fe, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
AF2419
Species: Hu
Applications: ICC, IHC, Simple Western, WB
H00003216-M01-100ug
Species: Hu
Applications: ELISA, WB
NBP2-83058
Species: Hu
Applications: WB

Publications for HOXA6 Antibody (NBP1-98346) (0)

There are no publications for HOXA6 Antibody (NBP1-98346).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXA6 Antibody (NBP1-98346) (0)

There are no reviews for HOXA6 Antibody (NBP1-98346). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXA6 Antibody (NBP1-98346) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HOXA6 Products

Bioinformatics Tool for HOXA6 Antibody (NBP1-98346)

Discover related pathways, diseases and genes to HOXA6 Antibody (NBP1-98346). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXA6 Antibody (NBP1-98346)

Discover more about diseases related to HOXA6 Antibody (NBP1-98346).
 

Pathways for HOXA6 Antibody (NBP1-98346)

View related products by pathway.

PTMs for HOXA6 Antibody (NBP1-98346)

Learn more about PTMs related to HOXA6 Antibody (NBP1-98346).

Blogs on HOXA6

There are no specific blogs for HOXA6, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXA6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXA6
Uniprot