Recombinant Human HOXA5 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human HOXA5 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 171 - 270 of Human HOXA5 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PAQPQIYPWMRKLHISHDNIGGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSMAAAGGAFRP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
HOXA5
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HOXA5 Protein

  • homeo box 1C
  • homeo box A5
  • homeobox A5
  • Homeobox protein Hox-1C
  • homeobox protein HOXA5
  • homeobox protein Hox-A5
  • HOX1
  • HOX1.3
  • HOX1CMGC9376

Background

HOXA5 - homeobox A5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32515
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24633
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB
H00003204-M01
Species: Hu
Applications: WB, ELISA
NBL1-11664
Species: Hu
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-14098
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003232-M09
Species: Hu
Applications: WB, ELISA, ICC/IF
H00003216-M01-100ug
Species: Hu
Applications: WB, ELISA
NBP1-52085
Species: Hu, Mu
Applications: WB, PEP-ELISA
NBP2-56557
Species: Hu
Applications: ICC/IF
NBP2-24561
Species: Hu, Mu, Rt, Bv, Fe, Pm
Applications: WB, IHC-P
H00003223-M04
Species: Hu
Applications: WB, ELISA
NBP2-57662
Species: Hu
Applications: ICC/IF
NBP1-83236
Species: Hu
Applications: WB, IHC, IHC-P
AF6318
Species: Hu
Applications: ICC
AF2400
Species: Hu
Applications: WB, ChIP, ICC
24420002
Species: Hu
Applications: ELISA, IHC, IHC-P
NBP2-56537
Species: Hu
Applications: ICC/IF

Publications for HOXA5 Partial Recombinant Protein (H00003202-Q01) (0)

There are no publications for HOXA5 Partial Recombinant Protein (H00003202-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXA5 Partial Recombinant Protein (H00003202-Q01) (0)

There are no reviews for HOXA5 Partial Recombinant Protein (H00003202-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXA5 Partial Recombinant Protein (H00003202-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HOXA5 Products

Bioinformatics Tool for HOXA5 Partial Recombinant Protein (H00003202-Q01)

Discover related pathways, diseases and genes to HOXA5 Partial Recombinant Protein (H00003202-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXA5 Partial Recombinant Protein (H00003202-Q01)

Discover more about diseases related to HOXA5 Partial Recombinant Protein (H00003202-Q01).
 

Pathways for HOXA5 Partial Recombinant Protein (H00003202-Q01)

View related products by pathway.

PTMs for HOXA5 Partial Recombinant Protein (H00003202-Q01)

Learn more about PTMs related to HOXA5 Partial Recombinant Protein (H00003202-Q01).
 

Research Areas for HOXA5 Partial Recombinant Protein (H00003202-Q01)

Find related products by research area.

Blogs on HOXA5

There are no specific blogs for HOXA5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

HOXA5 Antibody
NBP1-83235

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HOXA5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXA5