HOOK3 Antibody - BSA Free

Western Blot: HOOK3 Antibody [NBP1-81743] - Analysis in human cell line U-2 OS and human cell line MCF-7.

Immunohistochemistry-Paraffin: HOOK3 Antibody [NBP1-81743] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HOOK3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HOOK3 Antibody - BSA Free (NBP1-81743) is a polyclonal antibody validated for use in IHC and WB. Anti-HOOK3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KEEIAQRCHELDMQVAALQEEKSSLLAENQVLMERLNQSDSIEDPNSPAGRRHLQLQTQLEQLQEETFRLEA
• Predicted Species: Mouse (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HOOK3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: IHC reported in scientific literature (PMID: 26230842). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  HOOK3 Protein (NBP1-81743PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26230842).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HOOK3 Antibody - BSA Free

• FLJ31058
• hHK3
• HK3h-hook3
• hook homolog 3 (Drosophila)
• protein Hook homolog 3

Background

Hook proteins are cytosolic coiled-coil proteins that contain conserved N-terminal domains, which attach to microtubules, and more divergent C-terminal domains, which mediate binding to organelles. The Drosophila Hook protein is a component of the endocytic compartment.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HOOK3 Antibody (NBP1-81743)(1)

Publication using NBP1-81743

• Melling N, Harutyunyan L, Hube-Magg C et al. High-Level HOOK3 Expression Is an Independent Predictor of Poor Prognosis Associated with Genomic Instability in Prostate Cancer. PLoS One 2015-01-01 [PMID: 26230842] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: HOOK3