HOIP/RNF31 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HOIP/RNF31 Antibody [NBP2-48914] - Staining of human cell line PC-3 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HOIP/RNF31 Antibody [NBP2-48914] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HOIP/RNF31 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ELALSLLQETPRNYELGDVVEAVRHSQDRAFLRRLLAQECAVCGWALPHNRMQALTSCECTICPDCFRQHFTIALKEKHITDMVCPACGRPDLTDDTQLLSYFSTLDIQLRESLEPDAYALFHKKLTEGV
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNF31
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HOIP/RNF31 Recombinant Protein Antigen (NBP2-48914PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HOIP/RNF31 Antibody

  • EC 6.3.2.-
  • FLJ10111
  • FLJ23501
  • HOIP
  • MGC19975
  • ring finger protein 31
  • RNF31
  • ZIBRA
  • ZIBRAHOIL-1-interacting protein
  • Zinc in-between-RING-finger ubiquitin-associated domain protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88301
Species: Hu, Mu
Applications: WB, IB
NBP2-27186
Species: Hu, Ca
Applications: WB, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NB100-56173
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56144
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
AF1458
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB100-56311
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52823
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF, KD
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
NBP2-02293
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for HOIP/RNF31 Antibody (NBP2-48914) (0)

There are no publications for HOIP/RNF31 Antibody (NBP2-48914).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOIP/RNF31 Antibody (NBP2-48914) (0)

There are no reviews for HOIP/RNF31 Antibody (NBP2-48914). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HOIP/RNF31 Antibody (NBP2-48914) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HOIP/RNF31 Products

Bioinformatics Tool for HOIP/RNF31 Antibody (NBP2-48914)

Discover related pathways, diseases and genes to HOIP/RNF31 Antibody (NBP2-48914). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOIP/RNF31 Antibody (NBP2-48914)

Discover more about diseases related to HOIP/RNF31 Antibody (NBP2-48914).
 

Pathways for HOIP/RNF31 Antibody (NBP2-48914)

View related products by pathway.

PTMs for HOIP/RNF31 Antibody (NBP2-48914)

Learn more about PTMs related to HOIP/RNF31 Antibody (NBP2-48914).

Blogs on HOIP/RNF31

There are no specific blogs for HOIP/RNF31, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOIP/RNF31 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF31