hnRNP-R Antibody [Janelia Fluor® 646] Summary
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 550-633 of human hnRNP-R (NP_005817.1).
Sequence: RGRGGGRGGRGAPPPPRGRGAPPPRGRAGYSQRGAPLGPPRGSRGGRGGPAQQQRGRGSRGSRGNRGGNVGGKRKADGYNQPDSKRRQTNNQQNWGSQPIAQQPLQQGGDYSGNYGYNNDNQEFYQDTYGQQWK |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
HNRNPR |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot
|
Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
Storage |
Store at 4C in the dark. |
Buffer |
50mM Sodium Borate |
Preservative |
0.05% Sodium Azide |
Purity |
Affinity purified |
Notes
Sold under license from the Howard Hughes Medical Institute, Janelia Research Campus.
Alternate Names for hnRNP-R Antibody [Janelia Fluor® 646]
Background
The hnRNP-R gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in th
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt, Xp, Ze
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Ma, Mar, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Rt
Applications: ICC, IHC, IP, KO, WB
Publications for hnRNP-R Antibody (NBP3-37918JF646) (0)
There are no publications for hnRNP-R Antibody (NBP3-37918JF646).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for hnRNP-R Antibody (NBP3-37918JF646) (0)
There are no reviews for hnRNP-R Antibody (NBP3-37918JF646).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for hnRNP-R Antibody (NBP3-37918JF646) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional hnRNP-R Products
Blogs on hnRNP-R