hnRNP K Antibody (3O5Y4)

Western Blot: hnRNP K Antibody (3O5Y4) [NBP3-15303] - Western blot analysis of extracts of various cell lines, using hnRNP K antibody (NBP3-15303) at 1:2000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunocytochemistry/Immunofluorescence: hnRNP K Antibody (3O5Y4) [NBP3-15303] - Immunofluorescence analysis of U-2 OS cells using hnRNP K Rabbit mAb (NBP3-15303) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: hnRNP K Antibody (3O5Y4) [NBP3-15303] - Immunohistochemistry of paraffin-embedded mouse brain using hnRNP K Rabbit mAb (NBP3-15303) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunocytochemistry/Immunofluorescence: hnRNP K Antibody (3O5Y4) [NBP3-15303] - Immunofluorescence analysis of C6 cells using hnRNP K Rabbit mAb (NBP3-15303) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: hnRNP K Antibody (3O5Y4) [NBP3-15303] - Immunofluorescence analysis of NIH-3T3 cells using hnRNP K Rabbit mAb (NBP3-15303) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: hnRNP K Antibody (3O5Y4) [NBP3-15303] - Immunohistochemistry of paraffin-embedded rat brain using hnRNP K Rabbit mAb (NBP3-15303) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: hnRNP K Antibody (3O5Y4) [NBP3-15303] - Immunohistochemistry of paraffin-embedded human esophageal using hnRNP K Rabbit mAb (NBP3-15303) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry: hnRNP K Antibody (3O5Y4) [NBP3-15303] - Immunohistochemistry analysis of hnRNP K in paraffin-embedded Human lung adenocarcinoma tissue using hnRNP K Rabbit mAb at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: hnRNP K Antibody (3O5Y4) [NBP3-15303] - Immunohistochemistry analysis of hnRNP K in paraffin-embedded human colon tissue using hnRNP K Rabbit mAb at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: hnRNP K Antibody (3O5Y4) [NBP3-15303] - Immunohistochemistry analysis of hnRNP K in paraffin-embedded mouse testis tissue using hnRNP K Rabbit mAb at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: hnRNP K Antibody (3O5Y4) [NBP3-15303] - Immunohistochemistry analysis of hnRNP K in paraffin-embedded rat colon tissue using hnRNP K Rabbit mAb at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: hnRNP K Antibody (3O5Y4) [NBP3-15303] - Immunohistochemistry analysis of hnRNP K in paraffin-embedded mouse liver tissue using hnRNP K Rabbit mAb at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: hnRNP K Antibody (3O5Y4) [NBP3-15303] - Immunohistochemistry analysis of hnRNP K in paraffin-embedded human tonsil tissue using hnRNP K Rabbit mAb at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: hnRNP K Antibody (3O5Y4) [NBP3-15303] - Immunohistochemistry analysis of hnRNP K in paraffin-embedded human cervix cancer tissue using hnRNP K Rabbit mAb at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: hnRNP K Antibody (3O5Y4) [NBP3-15303] - Immunohistochemistry analysis of hnRNP K in paraffin-embedded mouse colon tissue using hnRNP K Rabbit mAb at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: hnRNP K Antibody (3O5Y4) [NBP3-15303] - Immunohistochemistry analysis of hnRNP K in paraffin-embedded mouse spleen tissue using hnRNP K Rabbit mAb at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: hnRNP K Antibody (3O5Y4) [NBP3-15303] - Confocal imaging of U-2 0S cells using hnRNP K Rabbit mAb . The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 60x.

Immunohistochemistry: hnRNP K Antibody (3O5Y4) [NBP3-15303] - Immunohistochemistry analysis of hnRNP K in paraffin-embedded rat spleen tissue using hnRNP K Rabbit mAb at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: 3O5Y4
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

hnRNP K Antibody (3O5Y4) Summary

• Description: Novus Biologicals Rabbit hnRNP K Antibody (3O5Y4) (NBP3-15303) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human hnRNP K (P61978). METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEI
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: HNRNPK
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for hnRNP K Antibody (3O5Y4)

• dC-stretch binding protein
• FLJ41122
• heterogeneous nuclear ribonucleoprotein K
• hnRNP K
• transformation upregulated nuclear protein
• Transformation up-regulated nuclear protein
• TUNPHNRPKCSBP

Background

The hnRNP-K family of acidic nuclear proteins has been identified using a monoclonal antibody that distinguishes between quiescent and proliferating human keratinocytes. The family, which is composed of four major proteins (hnRNPs-K A, B, C and D) and their modified forms, is present in similar overall levels in quiescent and proliferating normal keratinocytes although clear differences were observed in the levels of some of the individual variants (1). hnRNP-K is an ancient RNA/DNA-binding protein that is involved in multiple processes that compose gene expression. The pleiotropic action of K protein reflects its ability to interact with different classes of factors, interactions that are regulated by extracellular signals (2). hnRNP-K has several different cellular roles including transcription, mRNA shuttling, RNA editing and translation. Several reports implicate hnRNP K having a role in tumorigenesis, for instance hnRNP K increases transcription of the oncogene c-myc and hnRNP K expression is regulated by the p53/MDM 2 pathway (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HNRNPK