hnRNP A1 Recombinant Protein Antigen

Images

 
There are currently no images for hnRNP A1 Protein (NBP2-14096PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

hnRNP A1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HNRNPA1.

Source: E. coli

Amino Acid Sequence: ETTDESLRSHFERWGMLTDCAVMRDPNTKRSRGFGFVTYATVEEVDAATNARPHKVDGKVVEPRRTVSREDYQRSGAHLTVKKIFVGGIKENTEKHQLRDYFEQHGKMEVIEIMTEAVARKGALPL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HNRNPA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14096.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for hnRNP A1 Recombinant Protein Antigen

  • Helix-destabilizing protein
  • heterogeneous nuclear ribonucleoprotein A1
  • heterogeneous nuclear ribonucleoprotein A1B protein
  • heterogeneous nuclear ribonucleoprotein B2 protein
  • heterogeneous nuclear ribonucleoprotein core protein A1
  • hnRNP A1
  • hnRNP core protein A1
  • hnRNPA1
  • hnRNP-A1
  • HNRPA1MGC102835
  • nuclear ribonucleoprotein particle A1 protein
  • single-strand DNA-binding protein UP1
  • Single-strand RNA-binding protein

Background

RNA polymerase II transcripts in the nucleus are in complex with several proteins called heterogeneous nuclear ribonucleoproteins (hnRNPs). These proteins are important in biological activities such as transcription, pre-mRNA processing, cytoplasmic mRNA translation and turnover. hnRNPs can be isolated either by immunoprecipitation or by sucrose gradient fractionation of cell extracts.1, 3, 4 Isolated hnRNPs consist of protein groups named A to U and many of these protein groups consist of more than one isoform. The major steady-state proteins of the isolated hnRNP complex are A1, A2, B1, B2, C1, and C2, with a range of molecular weight starting with 34 kDa up to 43 kDa.1, 3, 4 hnRNP-A1 is important in pre-mRNA processing and in mRNA export from the nucleus. The protein binds to its RNA target through a consensus RNA-binding site UAGGGU. The protein contains a 38-amino acid domain called M9, which is important for the interaction with the transportin protein, and therefore, for its import and export from the nucleus. RanGTP mediates dissociation of hnRNP-A1 from transportin. hnRNP-A1 is ubiquitously expressed with a higher expression in proliferating and/or transformed cells than in differentiated tissues.5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20324
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-89342
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-45570
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
AF6457
Species: Hu
Applications: WB
NBP2-45946
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-67150
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
NBP3-17255
Species: Hu
Applications: ICC/IF, WB
NBP1-59069
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-41367
Species: Hu, Mu, Po, Rt
Applications: IHC,  IHC-P, WB
NBP2-38806
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-19952
Species: Hu
Applications: ICC/IF, KD, WB
H00006607-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
NBP1-44634
Species: Bv, Hu
Applications: CyTOF-ready, Flow, IP
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-47290
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
MAB4218
Species: Hu
Applications: IHC, WB
NB100-1936
Species: Hu, Mu, Pm, Rt, Xp, Ze
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NB100-93304
Species: ChHa, Hu
Applications: IP, WB

Publications for hnRNP A1 Protein (NBP2-14096PEP) (0)

There are no publications for hnRNP A1 Protein (NBP2-14096PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for hnRNP A1 Protein (NBP2-14096PEP) (0)

There are no reviews for hnRNP A1 Protein (NBP2-14096PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for hnRNP A1 Protein (NBP2-14096PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional hnRNP A1 Products

Research Areas for hnRNP A1 Protein (NBP2-14096PEP)

Find related products by research area.

Blogs on hnRNP A1.

hnRNP A1 - a ribonucleoprotein regulating gene expression at many levels
Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) is an abundant ubiquitously expressed protein with important roles in the regulation of gene expression. hnRNP A1 is involved in transcription as well as the splicing, trafficking, and translati...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our hnRNP A1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HNRNPA1