We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human HNF-4 gamma/NR2A2 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related HNF-4 gamma/NR2A2 Peptides and Proteins

Order Details


    • Catalog Number
      H00003174-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human HNF-4 gamma/NR2A2 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 310-407 of Human HNF-4 gamma/NR2A2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: KLFGMVKIDNLLQEMLLGGASNDGSHLHHPMHPHLSQDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQ

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
HNF4G
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HNF-4 gamma/NR2A2 GST (N-Term) Protein

  • hepatocyte nuclear factor 4, gamma
  • hepatocyte nuclear factor 4-gamma
  • HNF4 gamma
  • HNF-4 gamma
  • HNF4G
  • HNF-4-gamma
  • NR2A2
  • NR2A2Nuclear receptor subfamily 2 group A member 2
  • NR2A3

Background

Hepatocyte nuclear factor 4 gamma (HNF4 gamma) is a NR2 Hepatocyte NF4-Like receptor of relatively unknown function. Although HNF4 gamma is structurally related to HNF4 alpha and is expressed together with HNF 4 Alpha in pancreatic islets, it does not play a major role in the etiology of early onset, autosomal dominant, non insulin-dependent type 2 diabetes or maturity-onset diabetes of the young, MODY1. A pseudogene of HNF4 gamma, located on chromosome 13 (13q14.11 - 13q14.3), has been recently identified using a comparative genomics approach. HNF4 gamma expression has been reported human pancreas, kidney, testis, small intestine, and colon. ESTs have been isolated from human tissue libraries, including cancerous brain and colon, and normal brain,stomach, and liver.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89679
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
AF4186
Species: Hu
Applications: ICC, WB
NBP1-33596
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, PAGE, WB
NBP1-89680
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP3-35145
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
H00001109-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
AF2400
Species: Hu
Applications: ChIP, ICC, IHC, Simple Western, WB
MAB6529
Species: Hu
Applications: Simple Western, WB
NBP1-31378
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF6277
Species: Hu
Applications: ICC, WB
AF2419
Species: Hu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
NBP3-48016
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NB300-581
Species: Am, Ca, Gp, Hu, Mu, Po, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP2-27196
Species: Bv, Ca, Ch, ChHa, Eq, Gp, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, RM, Ze
Applications: IHC,  IHC-P, KD, WB
NBP1-84080
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-87461
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-45354
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00003174-Q01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for HNF-4 gamma/NR2A2 Partial Recombinant Protein (H00003174-Q01) (0)

There are no publications for HNF-4 gamma/NR2A2 Partial Recombinant Protein (H00003174-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HNF-4 gamma/NR2A2 Partial Recombinant Protein (H00003174-Q01) (0)

There are no reviews for HNF-4 gamma/NR2A2 Partial Recombinant Protein (H00003174-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HNF-4 gamma/NR2A2 Partial Recombinant Protein (H00003174-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HNF-4 gamma/NR2A2 Products

Blogs on HNF-4 gamma/NR2A2

There are no specific blogs for HNF-4 gamma/NR2A2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HNF-4 gamma/NR2A2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HNF4G