Home » HMGCS1 » HMGCS1 Proteins » HMGCS1 Recombinant Protein Antigen

HMGCS1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for HMGCS1 Protein (NBP2-14094PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

HMGCS1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HMGCS1.

Source: E.coli

Amino Acid Sequence: TLYSLKVTQDATPGSALDKITASLCDLKSRLDSRTGVAPDVFAENMKLREDTHHLVNYIPQGSIDSLFEGTWY
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HMGCS1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-14094.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for HMGCS1 Recombinant Protein Antigen

  • 3-hydroxy-3-methylglutaryl coenzyme A (HMG-CoA) synthase
  • 3-hydroxy-3-methylglutaryl coenzyme A synthase
  • 3-hydroxy-3-methylglutaryl-CoA synthase 1 (soluble)
  • 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 1 (soluble)
  • EC 2.3.3.10
  • HMG-CoA synthase
  • HMGCS
  • hydroxymethylglutaryl-CoA synthase, cytoplasmic
  • MGC90332

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

HMG-CoA
Reductase/HMGCR Antib
NBP1-91996
Immunohistochemistry-Paraffin: HMG-CoA Reductase/HMGCR Antibody [NBP1-91996] - Staining of human skin shows moderate to strong cytoplasmic positivity in epidermal cells.
Immunohistochemistry-Paraffin: HMG-CoA Reductase/HMGCR Antibody [NBP1-91996] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: HMG-CoA Reductase/HMGCR Antibody [NBP1-91996] - Staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
HMGCS2 Antibody
NBP2-33908
Western Blot: HMGCS2 Antibody [NBP2-33908] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-272
Immunocytochemistry/Immunofluorescence: HMGCS2 Antibody [NBP2-33908] - Immunofluorescent staining of human cell line RT4 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HMGCS2 Antibody [NBP2-33908] - Staining in human liver and cerebral cortex tissues using anti-HMGCS2 antibody. Corresponding HMGCS2 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
LDL R Antibody (C7)
NBP1-78159
Western Blot: LDL R Antibody (C7) [NBP1-78159] - Total protein from human HeLa and HepG2 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 0.5 ug/ml anti-LDL receptor in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: LDL R Antibody (C7) [NBP1-78159] - Image from a customer review on porcine intestinal epithelial cells IPEC-J2.
Immunohistochemistry: LDL R Antibody (C7) [NBP1-78159] - IHC analysis of a formalin fixed paraffin embedded tissue section of human liver using LDL Receptor antibody (clone C7) with HRP-DAB based detection and hematoxylin counterstaining.
(1 Review)
(17 Publications)
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
PPAR alpha/NR1C1
Antibody (3B6/PPAR)
NB300-537
Western Blot: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - Analysis of 25 ug of Hela (Lane 1), Jurkat (Lane 2), and NIH-3T3 cell lysates (Lane 3) and a molecular weight protein ladder.
Flow Cytometry: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - An intracellular stain was performed on Jurkat cells with PPAR alpha/NR1C1 Antibody (3B6/PPAR) NB300-537AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Western Blot: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - 293T cell lysate. Image from verified customer review.
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
FDPS Antibody
NBP2-16463
Western Blot: FDPS Antibody [NBP2-16463] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with FDPS antibody [N1C3] diluted at 1:3000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: FDPS Antibody [NBP2-16463] - HeLa cells were fixed in ice-cold MeOH for 5 min. Green: FDPS protein stained by FDPS antibody [N1C3] diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Immunohistochemistry-Paraffin: FDPS Antibody [NBP2-16463] - Paraffin-embedded mouse kidney. FDPS antibody [N1C3] dilution: 1:500.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
SREBP1 Antibody
(2A4)
NB600-582
Western Blot: SREBP1 Antibody (2A4) [NB600-582] - Analysis of whole cell lysate from HeLa cells showing a single specific band for the expression of SREBP1 precursor protein (~120 kDa).
Simple Western: SREBP1 Antibody (2A4) [NB600-582] - Lane view shows a specific band for SREBP1 in 1.0 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(28 Publications)
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha
Applications: WB, Simple Western, IHC
ACAT1 Antibody
NBP1-89284
Western Blot: ACAT1 Antibody [NBP1-89284] - ACAT1 porcine cerebral cortex. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: ACAT1 Antibody [NBP1-89284] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ACAT1 Antibody [NBP1-89284] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
(1 Review)
(5 Publications)
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
PPAR gamma/NR1C3
Antibody
NBP2-22106
Western Blot: PPAR gamma/NR1C3 Antibody [NBP2-22106] - Total protein from 3T3-L1 mouse embryonic fibroblast adipose-like cell line, separated by 4-12% SDS-PAGE, transferred to nitrocellulose membrane and blocked in 5% non-fat milk for 1h at room temperature. The membrane was probed with anti-PPAR gamma 1:800 in non-fat milk. Lane 2-7 increasing protein concentration, undifferentiated adipocytes. Lane 8-13 increasing protein concentration, differentiated adipocytes. This image was submitted via customer review.
Immunohistochemistry-Paraffin: PPAR gamma Antibody [NBP2-22106] - IHC analysis of PPAR gamma in mouse liver.
Western Blot: PPAR gamma Antibody [NBP2-22106] - Western blot analysis of PPAR gamma in 1. human adipose and 2. human adrenal lysate.
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Fatty Acid
Synthase/FASN Antibod
NB400-114
Western Blot: Fatty Acid Synthase Antibody [NB400-114] - Expression of Fatty Acid Synthase in chicken hypothalamus. A: total RNA (1 ug) isolated from different tissues (brain, hypothalamus, liver and muscle) was subjected to RT-PCR using specific primers for chicken Fatty Acid Synthase (GenBank accession JO4485) or ribosomal 18S as a control (GenBank accession AF173612) B: tissue lysates (brain, hypothalmus, liver and muscle) were subjected to Western blot as described in MATERIALS AND METHODS. Blots were incubated with anti-Fatty Acid Synthase antibody and revealed by enhanced chemiluminescence. Picture compliments of Dridi S. et al, Am J Physiol Regul Integr Comp Physiol. 2006 Jul;291(1):R138-47. Epub 2006 Feb 2.
Immunocytochemistry/Immunofluorescence: Fatty Acid Synthase Antibody [NB400-114] - The Fas antibody was tested in MCF-7 cells at a 1:2000 dilution against Dylight 488 (Green). Alpha tubulin and nuclei were counterstained against Dylight 550 (Red) and DAPI (Blue), respectively.
Immunohistochemistry-Paraffin: Fatty Acid Synthase Antibody [NB400-114] - Immunohistochemical localization of FAS in chicken hypothalmus. Paraffin sections were obtained from 3-wk-old broiler chickens.
(2 Reviews)
(19 Publications)
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
CYP7A1 Antibody
(946902) [Unconjugate
MAB9120
CYP7A1 was detected in immersion fixed human hepatocytes induced with dexamethasone for 48 hours using Mouse Anti-Human CYP7A1 Polyclonal Antibody (Catalog # MAB9120) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (green). Specific staining was localized to endoplasmic reticula and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu
Applications: ICC
SQLE Knockout HeLa
Cell Lysate
NBP2-66139
SQLE Knockout HeLa Cell Lysate
Species: Hu
SREBP2 Antibody
(1D2)
NBP1-54446
Western Blot: SREBP2 Antibody (1D2) [NBP1-54446] - Lane1: HEp-2 cells. Lane 2: MCF-7 cells. Lane 3: LNCaP cells. Lane 4: HT1080 cells. Lane5 ZR75-1 cells.
Immunocytochemistry/Immunofluorescence: SREBP2 Antibody (1D2) [NBP1-54446] - SREBP2 (1D2) antibody was tested in HeLa cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
(14 Publications)
Species: Hu, Ch
Applications: WB, ELISA, GS, ICC/IF, IP
ACAT2 Antibody
(OTI3E2)
NBP2-02588
Western Blot: ACAT2 Antibody (3E2) [NBP2-02588] Analysis of extracts (35ug) from 9 different cell lines by using anti-ACAT2 monoclonal antibody.
Immunocytochemistry/Immunofluorescence: ACAT2 Antibody (3E2) [NBP2-02588] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY ACAT2.
Immunohistochemistry-Paraffin: ACAT2 Antibody (3E2) [NBP2-02588] - Staining of paraffin-embedded Human prostate tissue using anti-ACAT2 mouse monoclonal antibody.
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
FDFT1 Antibody
(OTI2F10)
NBP2-01170
Western Blot: FDFT1 Antibody (2F10) [NBP2-01170] Analysis of extracts (35ug) from 9 different cell lines by using anti-FDFT1 monoclonal antibody.
Immunocytochemistry/Immunofluorescence: FDFT1 Antibody (2F10) [NBP2-01170] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY FDFT1.
Immunohistochemistry-Paraffin: FDFT1 Antibody (2F10) [NBP2-01170] - Staining of paraffin-embedded Human prostate tissue using anti-FDFT1 mouse monoclonal antibody.
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
CNBP Antibody
NBP2-55690
Western Blot: CNBP Antibody [NBP2-55690] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/Immunofluorescence: CNBP Antibody [NBP2-55690] - Staining of human cell line SH-SY5Y shows localization to nucleus & cytosol.
Species: Hu
Applications: WB, ICC/IF
CPT2 Antibody
NBP1-85471
Western Blot: CPT2 Antibody [NBP1-85471] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: CPT2 Antibody [NBP1-85471] - Staining of human cell line A-431 shows localization to nucleoplasm, nucleoli & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CPT2 Antibody [NBP1-85471] - Staining in human kidney and skeletal muscle tissues using anti-CPT2 antibody. Corresponding CPT2 RNA-seq data are presented for the same tissues.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
GGPS1 Antibody
NBP1-83368
Western Blot: GGPS1 Antibody [NBP1-83368] - Analysis in human cell line RT-4.
Immunohistochemistry-Paraffin: GGPS1 Antibody [NBP1-83368] - Staining in human testis and pancreas tissues using anti-GGPS1 antibody. Corresponding GGPS1 RNA-seq data are presented for the same tissues.
Western Blot: GGPS1 Antibody [NBP1-83368] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Species: Hu
Applications: WB, IHC, IHC-P
MVK Antibody
[Unconjugated]
AF8516
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line, A431 human epithelial carcinoma cell line, and HEK001 human epidermal keratinocyte cell line. PVDF membrane was probed with 0.1 µg/mL of Rabbit Anti-Human MVK Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8516) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for MVK at approximately 42 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
MVK was detected in immersion fixed A431 human epithelial carcinoma cell line using Rabbit Anti-Human MVK Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8516) at 2 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rabbit IgG Secondary Antibody (red; Catalog # NL004) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
MVK was immunoprecipitated from 400 µg of HepG2 human hepatocellular carcinoma cell line and A431 human epithelial carcinoma cell line lysates using 4 µg of Rabbit Anti-Human MVK Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8516) coated on 4 wells of a 96 well plate (Corning Costar EIA/RIA). HepG2 lysates, A431 lysates, Rabbit IgG control buffer, or recombinant human MVK were added to the wells and incubated for 2 hours at room temperature. Immunoprecipitated MVK was detected by Western blot under reducing conditions using 0.1 µg/mL Rabbit Anti-Human MVK Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8516) and Immunoblot Buffer Group 1. View our recommended buffer recipes for Immunoprecipitation.
Species: Hu
Applications: WB, Simple Western, IP, ICC

Publications for HMGCS1 Protein (NBP2-14094PEP) (0)

There are no publications for HMGCS1 Protein (NBP2-14094PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HMGCS1 Protein (NBP2-14094PEP) (0)

There are no reviews for HMGCS1 Protein (NBP2-14094PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for HMGCS1 Protein (NBP2-14094PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for HMGCS1 Protein (NBP2-14094PEP)

Discover related pathways, diseases and genes to HMGCS1 Protein (NBP2-14094PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HMGCS1 Protein (NBP2-14094PEP)

Discover more about diseases related to HMGCS1 Protein (NBP2-14094PEP).
 

Pathways for HMGCS1 Protein (NBP2-14094PEP)

View related products by pathway.

PTMs for HMGCS1 Protein (NBP2-14094PEP)

Learn more about PTMs related to HMGCS1 Protein (NBP2-14094PEP).

Blogs on HMGCS1

There are no specific blogs for HMGCS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

HMGCS1 Recombinant Protein Antigen
NBP1-83246PEP
Western Blot: SREBP1 Antibody (2A4) [NB600-582] - Analysis of whole cell lysate from HeLa cells showing a single specific band for the expression of SREBP1 precursor protein (~120 kDa).
SREBP1 Antibody (2A4)
NB600-582
Western Blot: HMGCS1 Antibody [NBP2-16861] - Sample (50 ug of whole cell lysate) A: Mouse Liver, 7. 5% SDS PAGE gel, diluted at 1:1000.
HMGCS1 Antibody
NBP2-16861
Western Blot: Fatty Acid Synthase Antibody [NB400-114] - Expression of Fatty Acid Synthase in chicken hypothalamus. A: total RNA (1 ug) isolated from different tissues (brain, hypothalamus, liver and muscle) was subjected to RT-PCR using specific primers for chicken Fatty Acid Synthase (GenBank accession JO4485) or ribosomal 18S as a control (GenBank accession AF173612) B: tissue lysates (brain, hypothalmus, liver and muscle) were subjected to Western blot as described in MATERIALS AND METHODS. Blots were incubated with anti-Fatty Acid Synthase antibody and revealed by enhanced chemiluminescence. Picture compliments of Dridi S. et al, Am J Physiol Regul Integr Comp Physiol. 2006 Jul;291(1):R138-47. Epub 2006 Feb 2.
Fatty Acid Synthase/FASN Antibody
NB400-114

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HMGCS1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol HMGCS1