HLX1 Antibody [FITC]

Product Discontinued

HLX1 Antibody [FITC] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 80-280 of human HLX1 (NP_068777.1).
  
  Sequence:
  HPHASFQAAARSPLRPTPVVAPSEVPAGFPQRLSPLSAAYHHHHPQQQQQQQQPQQQQPPPPPRAGALQPPASGTRVVPNPHHSGSAPAPSSKDLKFGIDRILSAEFDPKVKEGNTLRDLTSLLTGGRPAGVHLSGLQPSAGQFFASLDPINEASAILSPLNSNPRNSVQHQFQDTFPGPYAVLTKDTMPQTYKRKRSWSR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HLX
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: PBS
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Alternate Names for HLX1 Antibody [FITC]

• H2.0 (Drosophila)-like homeo box 1
• H2.0-like homeo box 1
• H2.0-like homeo box-1
• H2.0-like homeobox 1
• H2.0-like homeobox protein
• H2.0-like homeobox
• HB24
• HLX1H2.0-like homeobox 1 (Drosophila)
• Homeobox protein HB24
• Homeobox protein HLX1

Background

Transcription factor required for TBX21/T-bet-dependent maturation of Th1 cells as well as maintenance ofTh1-specific gene expression. Involved in embryogenesis and hematopoiesis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HLX