HLA DRB3 Antibody

Images

 
Western Blot: HLA DRB3 Antibody [NBP2-82248] - WB Suggested Anti-HLA-DRB3 Antibody. Titration: 1.0 ug/ml. Positive Control: U937 Whole Cell

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HLA DRB3 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of HLA DRB3. Peptide sequence: GFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEV The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
HLA-DRB3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HLA DRB3 Antibody

  • DR7
  • HLA class II histocompatibility antigen, DR beta 3 chain
  • HLA class II histocompatibility antigen, DRB1-7 beta chain
  • HLA-DR3B
  • HLA-DR52
  • HLA-DRB1
  • human leucocyte antigen DRB3
  • major histocompatibility complex, class II, DR beta 3
  • MGC117330
  • MHC class II antigen DR beta 3 chain
  • MHC class II antigen DRB3
  • MHC class II HLA-DR beta 3 chain

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003126-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-61871
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB100-64775
Species: Pm, Bv, Hu, Mu, Pm
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P (-), IP
NBP3-16006
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-17054
Species: Hu
Applications: ELISA, ICC/IF, IHC-P, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-53380
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-14093
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-26116
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-32005
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-47480
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56618
Species: Hu, Mu
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-P, WB
MAB943
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
NBP2-50419
Species: Hu, Mu
Applications: CyTOF-ready, Flow, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP2-66995
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
7268-CT
Species: Hu
Applications: BA
MAB3428
Species: Hu
Applications: IHC, WB

Publications for HLA DRB3 Antibody (NBP2-82248) (0)

There are no publications for HLA DRB3 Antibody (NBP2-82248).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HLA DRB3 Antibody (NBP2-82248) (0)

There are no reviews for HLA DRB3 Antibody (NBP2-82248). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HLA DRB3 Antibody (NBP2-82248) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HLA DRB3 Products

Bioinformatics Tool for HLA DRB3 Antibody (NBP2-82248)

Discover related pathways, diseases and genes to HLA DRB3 Antibody (NBP2-82248). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HLA DRB3 Antibody (NBP2-82248)

Discover more about diseases related to HLA DRB3 Antibody (NBP2-82248).
 

Pathways for HLA DRB3 Antibody (NBP2-82248)

View related products by pathway.

Research Areas for HLA DRB3 Antibody (NBP2-82248)

Find related products by research area.

Blogs on HLA DRB3

There are no specific blogs for HLA DRB3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HLA DRB3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HLA-DRB3