HLA DRB3 Antibody

Images

 
Western Blot: HLA DRB3 Antibody [H00003125-B02P] - Analysis of HLA-DRB3 expression in human liver.
Flow Cytometry: HLA DRB3 Antibody [H00003125-B02P] - Analysis of negative control 293 cells (Black) and HLA-DRB3 expressing 293 cells (Green) using HLA-DRB3 purified mouse polyclonal antibody.
Western Blot: HLA DRB3 Antibody [H00003125-B02P] - Analysis of HLA-DRB3 expression in transfected 293T cell line by HLA-DRB3 polyclonal antibody. Lane 1: HLA-DRB3 transfected lysate(29.26 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Flow
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HLA DRB3 Antibody Summary

Immunogen
HLA-DRB3 (NP_072049.2, 1 a.a. - 266 a.a.) full-length human protein. MVCLKLPGGSSLAALTVTLMVLSSRLAFAGDTRPRFLELRKSECHFFNGTERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSALTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS
Specificity
HLA-DRB3 - major histocompatibility complex, class II, DR beta 3,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
HLA-DRB3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Flow Cytometry
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been use for FACS.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HLA DRB3 Antibody

  • DR7
  • HLA class II histocompatibility antigen, DR beta 3 chain
  • HLA class II histocompatibility antigen, DRB1-7 beta chain
  • HLA-DR3B
  • HLA-DR52
  • HLA-DRB1
  • human leucocyte antigen DRB3
  • major histocompatibility complex, class II, DR beta 3
  • MGC117330
  • MHC class II antigen DR beta 3 chain
  • MHC class II antigen DRB3
  • MHC class II HLA-DR beta 3 chain

Background

HLA-DRB3 belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DRA) and a beta (DRB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DR molecule the beta chain contains all the polymorphisms specifying the peptide binding specificities. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. DRB1 is expressed at a level five times higher than its paralogues DRB3, DRB4 and DRB5. The presence of DRB3 is linked with allelic variants of DRB1, otherwise it is omitted. There are 4 related pseudogenes: DRB2, DRB6, DRB7, DRB8 and DRB9. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
AF347
Species: Hu
Applications: WB, IHC, Neut
NB120-17101
Species: Hu
Applications: IHC, IHC-P
NBP2-14984
Species: Hu
Applications: WB, IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-53380
Species: Hu
Applications: ICC/IF, IHC-P, PAGE
NBP2-14093
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NBP2-66139
Species: Hu
H00001810-B01P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB943
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
NBP2-50419
Species: Hu
Applications: Flow, IP, CyTOF-ready
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14893
Species: Hu
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
MAB3428
Species: Hu
Applications: WB, IHC

Publications for HLA DRB3 Antibody (H00003125-B02P) (0)

There are no publications for HLA DRB3 Antibody (H00003125-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HLA DRB3 Antibody (H00003125-B02P) (0)

There are no reviews for HLA DRB3 Antibody (H00003125-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HLA DRB3 Antibody (H00003125-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HLA DRB3 Products

Bioinformatics Tool for HLA DRB3 Antibody (H00003125-B02P)

Discover related pathways, diseases and genes to HLA DRB3 Antibody (H00003125-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HLA DRB3 Antibody (H00003125-B02P)

Discover more about diseases related to HLA DRB3 Antibody (H00003125-B02P).
 

Pathways for HLA DRB3 Antibody (H00003125-B02P)

View related products by pathway.

Research Areas for HLA DRB3 Antibody (H00003125-B02P)

Find related products by research area.

Blogs on HLA DRB3

There are no specific blogs for HLA DRB3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HLA DRB3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HLA-DRB3
Entrez
Uniprot