HLA DQB1 Antibody

Images

 
Western Blot: HLA DQB1 Antibody [NBP1-84549] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunohistochemistry-Paraffin: HLA DQB1 Antibody [NBP1-84549] - Staining of human lymph node shows strong cytoplasmic positivity in reaction center cells, lymphoid cells outside reaction centra.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HLA DQB1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RPDAEYWNSQKEVLEGTRAELDTVCRHNYEVAFRGILQRRVEPTVTISPSRTEALNHHNLLVCSVT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HLA-DQB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
Brain Corpus Callosum Lysate (NB820-59397)
Control Peptide
HLA DQB1 Protein (NBP1-84549PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HLA DQB1 Antibody

  • DC-1 alpha chain
  • DC-alpha
  • HLA class II histocompatibility antigen, DQ alpha 1 chain-like
  • HLA-DCA
  • MHC class II DQA1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-61007
Species: Hu, Alp, AB, Bv, Ca, Eq, Fe, Ft, Gt, Ha, Ll, Mn, Rb, Sh, WB
Applications: Flow, Func, IHC
NBP2-14093
Species: Hu
Applications: WB, IHC, IHC-P
H00003125-B02P
Species: Hu
Applications: WB, Flow
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-53380
Species: Hu
Applications: ICC/IF, IHC-P, PAGE
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-50419
Species: Hu
Applications: Flow, IP, CyTOF-ready
AF347
Species: Hu
Applications: WB, IHC, Neut
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP1-33284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB3428
Species: Hu
Applications: WB, IHC
NBP1-32421
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84549
Species: Hu
Applications: WB, IHC, IHC-P

Publications for HLA DQB1 Antibody (NBP1-84549) (0)

There are no publications for HLA DQB1 Antibody (NBP1-84549).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HLA DQB1 Antibody (NBP1-84549) (0)

There are no reviews for HLA DQB1 Antibody (NBP1-84549). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HLA DQB1 Antibody (NBP1-84549) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional HLA DQB1 Products

Bioinformatics Tool for HLA DQB1 Antibody (NBP1-84549)

Discover related pathways, diseases and genes to HLA DQB1 Antibody (NBP1-84549). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HLA DQB1 Antibody (NBP1-84549)

Discover more about diseases related to HLA DQB1 Antibody (NBP1-84549).
 

Pathways for HLA DQB1 Antibody (NBP1-84549)

View related products by pathway.

PTMs for HLA DQB1 Antibody (NBP1-84549)

Learn more about PTMs related to HLA DQB1 Antibody (NBP1-84549).
 

Research Areas for HLA DQB1 Antibody (NBP1-84549)

Find related products by research area.

Blogs on HLA DQB1

There are no specific blogs for HLA DQB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HLA DQB1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HLA-DQB1