Histone H2A.Z Antibody (2X2I10)

Western Blot: Histone H2A.Z Antibody (2X2I10) [NBP3-16447] - Western blot analysis of extracts of various cell lines, using Histone H2A.Z Rabbit mAb (NBP3-16447) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Chromatin Immunoprecipitation: Histone H2A.Z Antibody (2X2I10) [NBP3-16447] - Chromatin immunoprecipitation analysis of extracts of HeLa cells, using Histone H2A.Z Rabbit mAb antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Western Blot: Histone H2A.Z Antibody (2X2I10) [NBP3-16447] - Western blot analysis of lysates from wild type(WT) and Histone H2A.Z knockout (KO) 293T(KO) cells, using [KO Validated] Histone H2A.Z Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.

Chromatin Immunoprecipitation: Histone H2A.Z Antibody (2X2I10) [Histone H2A.Z] - Chromatin immunoprecipitation analysis of extracts of HeLa cells, using Histone H2A.Z Rabbit mAb antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Western Blot: Histone H2A.Z Antibody (2X2I10) [Histone H2A.Z] - Western blot analysis of lysates from wild type(WT) and Histone H2A.Z knockout (KO) 293T(KO) cells, using [KO Validated] Histone H2A.Z Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 1s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ChIP
• Clone: 2X2I10
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Histone H2A.Z Antibody (2X2I10) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H2A.Z (P0C0S5). MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSL
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: H2AZ1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation (ChIP) 1:50-1:200
  • Western Blot 1:1000 - 1:5000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Histone H2A.Z Antibody (2X2I10)

• H2A histone family, member Z
• H2A.z
• H2A/z
• H2AZ histone
• H2AZMGC117173
• histone H2A.Z

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: H2AZ1