Recombinant Human HIST1H2AM Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human HIST1H2AM Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-130 of Human HIST1H2AM full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
HIST1H2AM
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
39.93 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HIST1H2AM Protein

  • H2A histone family, member N
  • H2A.1HIST1H2AL
  • H2A/n
  • H2AFC
  • H2AFD
  • H2AFI
  • H2AFNdJ193B12.1
  • H2AFP
  • HIST1H2AG
  • HIST1H2AI
  • HIST1H2AK
  • histone 1, H2am
  • histone cluster 1, H2am
  • histone H2A type 1
  • Histone H2A/p

Background

HIST1H2AM( AAH32756, 1 a.a. - 131 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008337-P01
Species: Hu
NBP2-67336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-07996
Species: Hu
NBP2-52487
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
H00008349-M06
Species: Hu
Applications: ELISA, IHC-P
NBP2-54619
Species: Hu, Mu
Applications: WB, ChIP, DB, ELISA, ICC/IF, IF
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NB21-1023
Species: Hu, Mu, Ce
Applications: WB, ChIP, DB, ICC/IF
NB100-81964
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-07993
Species: Hu
NBP2-46688
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-61153
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00008294-P01
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
H00008360-R01
Species: Hu
H00008363-P01
Species: Hu
H00008362-P01
Species: Hu
H00008336-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for HIST1H2AM Recombinant Protein (H00008336-P01) (0)

There are no publications for HIST1H2AM Recombinant Protein (H00008336-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HIST1H2AM Recombinant Protein (H00008336-P01) (0)

There are no reviews for HIST1H2AM Recombinant Protein (H00008336-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HIST1H2AM Recombinant Protein (H00008336-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HIST1H2AM Products

HIST1H2AM H00008336-P01

Bioinformatics Tool for HIST1H2AM Recombinant Protein (H00008336-P01)

Discover related pathways, diseases and genes to HIST1H2AM Recombinant Protein (H00008336-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on HIST1H2AM

There are no specific blogs for HIST1H2AM, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HIST1H2AM Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HIST1H2AM