Recombinant Human HIST1H2AK Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human HIST1H2AK Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-130 of Human HIST1H2AK full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK

Protein/Peptide Type
Recombinant Protein
Gene
HIST1H2AK

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HIST1H2AK Protein

  • H2A histone family, member D
  • H2A.1
  • H2A/d
  • H2AFC
  • H2AFDhistone H2A type 1
  • H2AFI
  • H2AFN
  • H2AFP
  • HIST1H2AG
  • HIST1H2AI
  • HIST1H2AJ
  • HIST1H2AL
  • HIST1H2AM
  • histone 1, H2ak
  • histone cluster 1, H2ak
  • histone H2A type 1-J
  • histone H2A/e
  • Histone H2A/p

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H2A family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the small histone gene cluster on chromosome 6p22-p21.3. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58095
Species: Hu
Applications: WB
NBP2-61489
Species: Hu, Vb
Applications: WB, ELISA, ICC/IF
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
H00008349-M06
Species: Hu
Applications: ELISA, IHC-P
NBP2-54619
Species: Hu, Mu
Applications: WB, ChIP, DB, ELISA, IF
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NB21-1023
Species: Hu, Mu, Ce
Applications: WB, ChIP, DB, ICC/IF
NB100-81964
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-07993
Species: Hu
NBP2-46688
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-31878
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBL1-11569
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
H00008360-R01
Species: Hu
NBL1-11570
Species: Hu
NBP2-10888
Species: Hu

Publications for HIST1H2AK Recombinant Protein (H00008330-P01) (0)

There are no publications for HIST1H2AK Recombinant Protein (H00008330-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HIST1H2AK Recombinant Protein (H00008330-P01) (0)

There are no reviews for HIST1H2AK Recombinant Protein (H00008330-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HIST1H2AK Recombinant Protein (H00008330-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HIST1H2AK Products

HIST1H2AK H00008330-P01

Bioinformatics Tool for HIST1H2AK Recombinant Protein (H00008330-P01)

Discover related pathways, diseases and genes to HIST1H2AK Recombinant Protein (H00008330-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on HIST1H2AK

There are no specific blogs for HIST1H2AK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

HIST1H2AK RNAi
H00008330-R01-20nmol

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HIST1H2AK Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HIST1H2AK