HIPPI Antibody

Images

 
Western Blot: HIPPI Antibody [NBP1-84787] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: HIPPI Antibody [NBP1-84787] - Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear speckles & cytosol.
Immunohistochemistry-Paraffin: HIPPI Antibody [NBP1-84787] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HIPPI Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RSFGRTADFPPSKLKSGYGEHVCYVLDCFAEEALKYIGFTWKRPIYPVEELEEESVAEDDAELTLNKVDEEFVEEETDNEENFIDLN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IFT57
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HIPPI Protein (NBP1-84787PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HIPPI Antibody

  • Dermal papilla-derived protein 8
  • DERP8
  • ESRRBL1huntingtin interacting protein-1 interacting protein
  • estrogen-related receptor beta like 1
  • Estrogen-related receptor beta-like protein 1
  • FLJ10147
  • HIPPIHIP1-interacting protein
  • intraflagellar transport 57 homolog (Chlamydomonas)
  • intraflagellar transport protein 57 homolog
  • MHS4R2HIP1 protein interactor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-203
Species: Hu, Mu, Rt(-)
Applications: WB, ChIP, ICC/IF, IHC-P, IP
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-89843
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56094
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00006532-M06
Species: Hu
Applications: ELISA, IP
NB100-2475
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-02009
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-757
Species: Hu
Applications: WB, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-55756
Species: Hu
Applications: IHC-P
NBP1-90944
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-86424
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20891
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-15564
Species: Hu, Rt
Applications: WB, IHC, IHC-P

Publications for HIPPI Antibody (NBP1-84787) (0)

There are no publications for HIPPI Antibody (NBP1-84787).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HIPPI Antibody (NBP1-84787) (0)

There are no reviews for HIPPI Antibody (NBP1-84787). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HIPPI Antibody (NBP1-84787) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HIPPI Products

Bioinformatics Tool for HIPPI Antibody (NBP1-84787)

Discover related pathways, diseases and genes to HIPPI Antibody (NBP1-84787). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HIPPI Antibody (NBP1-84787)

Discover more about diseases related to HIPPI Antibody (NBP1-84787).
 

Pathways for HIPPI Antibody (NBP1-84787)

View related products by pathway.

PTMs for HIPPI Antibody (NBP1-84787)

Learn more about PTMs related to HIPPI Antibody (NBP1-84787).

Blogs on HIPPI

There are no specific blogs for HIPPI, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HIPPI Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IFT57