HIPK2 Antibody (1D8) - Azide and BSA Free

Western Blot: HIPK2 Antibody (1D8) [H00028996-M08] - Detection against Immunogen (34.91 KDa).

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1D8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

HIPK2 Antibody (1D8) - Azide and BSA Free Summary

• Immunogen: HIPK2 (NP_073577.2, 213 a.a. ~ 293 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PSSTSATISLANPEVSILNYPSTLYQPSAASMAAVAQRSMPLQTGTAQICARPDPFQQAL IVCPPGFQGLQASPSKHAGYS
• Specificity: HIPK2 (1D8)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: HIPK2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HIPK2 Antibody (1D8) - Azide and BSA Free

• DKFZp686K02111
• EC 2.7.11.1
• FLJ23711
• hHIPk2
• HIPK2
• homeodomain interacting protein kinase 2
• homeodomain-interacting protein kinase 2
• PRO0593
• Stank

Background

HIPK2 is a conserved serine/threonine nuclear kinase that interacts with homeodomain transcription factors.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HIPK2
• Entrez:
  • 28996(Human)
• OMIM:
  • 606868(Human)
• Uniprot:
  • NP_073577(Human)