HIP1 Recombinant Protein Antigen

Images

 
There are currently no images for HIP1 Protein (NBP1-81592PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HIP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HIP1.

Source: E. coli

Amino Acid Sequence: NFLRASALSEHISPVVVIPAEASSPDSEPVLEKDDLMDMDASQQNLFDNKFDDIFGSSFSSDPFNFNSQNGVNKDEKDHLIERLYREISGLKAQLENMKTESQRVVLQLKGHVSELEADLAEQQHLRQQAADDCEFLRAELDELRRQRED

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HIP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81592.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HIP1 Recombinant Protein Antigen

  • HIP-1
  • HIP-I
  • huntingtin interacting protein 1
  • huntingtin-interacting protein 1
  • Huntingtin-interacting protein I
  • ILWEQ
  • MGC126506

Background

Huntingtin Interacting Protein (HIP1) is a reportedly proapoptotic, cargo-specific adaptor protein that may be involved in the pathogenesis of Huntingtin's disease. Huntingtin's is a neurodegenerate disease caused by the expansion of a polymorphic glutamine tract in Huntingtin.

In addition to playing a role in Huntingtin disease, HIP1 is likely to be involved in the recruitment of clathrin coats to lipid membranes, and it may also factor in tumorigenesis by allowing the survival of precancerous and cancerous cells. Since HIP-1 expression is significantly associated with prostate and colon cancer metastasis, HIP-1 can serve as a putative prognostic factor for prostate and colon cancers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-15642
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB300-206
Species: Ba, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP2-02313
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-05546
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, WB
NB100-116
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, PLA, Simple Western, WB
NBP3-25690
Species: Fe, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-45867
Species: Hu
Applications: Flow, IHC,  IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NB110-74569
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP3-03807
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
AF1443
Species: Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP2-04017
Species: Hu
Applications: IP, WB
NB600-600
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, IB, ICC/IF, IHC,  IHC-P, KD, WB
2914-HT
Species: Hu
Applications: BA
NB100-74359
Species: Ch, Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-85570
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
DBD00
Species: Hu
Applications: ELISA

Publications for HIP1 Protein (NBP1-81592PEP) (0)

There are no publications for HIP1 Protein (NBP1-81592PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HIP1 Protein (NBP1-81592PEP) (0)

There are no reviews for HIP1 Protein (NBP1-81592PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HIP1 Protein (NBP1-81592PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HIP1 Products

Array NBP1-81592PEP

Research Areas for HIP1 Protein (NBP1-81592PEP)

Find related products by research area.

Blogs on HIP1

There are no specific blogs for HIP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HIP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HIP1