HIP1 Antibody (1E9)

Images

 
Sandwich ELISA: HIP1 Antibody (1E9) [H00003092-M02] - Detection limit for recombinant GST tagged HIP1 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1E9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HIP1 Antibody (1E9) Summary

Immunogen
HIP1 (NP_005329 928 a.a. - 1037 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DSPNLAQLQQASRGVNQATAGVVASTISGKSQIEETDNMDFSSMTLTQIKRQEMDSQVRVLELENELQKERQKLGELRKKHYELAGVAEGWEEGTEASPPTLQEVVTEKE
Specificity
HIP1 - huntingtin interacting protein 1 (1E9)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HIP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HIP1 Antibody (1E9)

  • HIP-1
  • HIP-I
  • huntingtin interacting protein 1
  • huntingtin-interacting protein 1
  • Huntingtin-interacting protein I
  • ILWEQ
  • MGC126506

Background

The product of this gene is a membrane-associated protein that colocalizes with huntingtin. This protein has similarities to cytoskeleton proteins and its interaction with huntingtin is thought to play a functional role in the cell filament network. Loss of normal huntingtin-HIP1 interaction in Huntington disease may contribute to a defect in membrane-cytoskeletal integrity in the brain. This gene could help in the understanding of the normal function of huntingtin and also the pathogenesis of Huntington disease. It also has been implicated in the pathogenesis of hematopoietic malignancies. An alternative splice variant of this gene has been described but its full length sequence has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NB300-206
Species: Hu, Mu, Rt, Ba
Applications: WB, IHC, IP
NBP2-02313
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006532-M06
Species: Hu
Applications: ELISA, IP
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NBP1-90146
Species: Hu
Applications: IHC, IHC-P
NBP2-45867
Species: Hu
Applications: WB, Flow, IHC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB110-74569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-89843
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00009685-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq

Publications for HIP1 Antibody (H00003092-M02) (0)

There are no publications for HIP1 Antibody (H00003092-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HIP1 Antibody (H00003092-M02) (0)

There are no reviews for HIP1 Antibody (H00003092-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HIP1 Antibody (H00003092-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HIP1 Products

Bioinformatics Tool for HIP1 Antibody (H00003092-M02)

Discover related pathways, diseases and genes to HIP1 Antibody (H00003092-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HIP1 Antibody (H00003092-M02)

Discover more about diseases related to HIP1 Antibody (H00003092-M02).
 

Pathways for HIP1 Antibody (H00003092-M02)

View related products by pathway.

PTMs for HIP1 Antibody (H00003092-M02)

Learn more about PTMs related to HIP1 Antibody (H00003092-M02).

Blogs on HIP1

There are no specific blogs for HIP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HIP1 Antibody (1E9) and receive a gift card or discount.

Bioinformatics

Gene Symbol HIP1
Entrez
Uniprot