Recombinant Human HGK/MAP4K4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human HGK/MAP4K4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 611-710 of Human MAP4K4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VHPALQRPAEPQVQWSHLASLKNNVSPVSRSHSFSDPSPKFAHHHLRSQDPCPPSRSEVLSQSSDSKSEAPDPTQKAWSRSDSDEVPPRVPVRTTSRSPV

Protein/Peptide Type
Partial Recombinant Protein
Gene
MAP4K4

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HGK/MAP4K4 Protein

  • EC 2.7.11
  • EC 2.7.11.1
  • FLH21957
  • FLJ10410
  • hepatocyte progenitor kinase-like/germinal center kinase-like kinase
  • HGK
  • HGKFLJ20373
  • HPK/GCK-like kinase HGK
  • KIAA0687
  • MAP4K4
  • MAPK/ERK kinase kinase kinase 4
  • MEK kinase kinase 4
  • MEKKK 4
  • MEKKK4
  • mitogen-activated protein kinase kinase kinase kinase 4
  • Nck-interacting kinase
  • NIKFLJ90111

Background

MAP4K4 - mitogen-activated protein kinase kinase kinase kinase 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56509
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-56704
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC-Fr, IHC-P, IP, Flow-IC
NB100-56144
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NB100-56507
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
MAB3199
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-87760
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB110-40561
Species: Hu
Applications: WB, IP
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00002288-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P, IP
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC

Publications for HGK/MAP4K4 Partial Recombinant Protein (H00009448-Q01) (0)

There are no publications for HGK/MAP4K4 Partial Recombinant Protein (H00009448-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HGK/MAP4K4 Partial Recombinant Protein (H00009448-Q01) (0)

There are no reviews for HGK/MAP4K4 Partial Recombinant Protein (H00009448-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HGK/MAP4K4 Partial Recombinant Protein (H00009448-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HGK/MAP4K4 Products

Bioinformatics Tool for HGK/MAP4K4 Partial Recombinant Protein (H00009448-Q01)

Discover related pathways, diseases and genes to HGK/MAP4K4 Partial Recombinant Protein (H00009448-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HGK/MAP4K4 Partial Recombinant Protein (H00009448-Q01)

Discover more about diseases related to HGK/MAP4K4 Partial Recombinant Protein (H00009448-Q01).
 

Pathways for HGK/MAP4K4 Partial Recombinant Protein (H00009448-Q01)

View related products by pathway.

PTMs for HGK/MAP4K4 Partial Recombinant Protein (H00009448-Q01)

Learn more about PTMs related to HGK/MAP4K4 Partial Recombinant Protein (H00009448-Q01).
 

Research Areas for HGK/MAP4K4 Partial Recombinant Protein (H00009448-Q01)

Find related products by research area.

Blogs on HGK/MAP4K4

There are no specific blogs for HGK/MAP4K4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HGK/MAP4K4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MAP4K4
Entrez