HGD Antibody

Images

 
Western Blot: HGD Antibody [NBP2-33488] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver ...read more
Immunocytochemistry/ Immunofluorescence: HGD Antibody [NBP2-33488] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli.
Immunohistochemistry-Paraffin: HGD Antibody [NBP2-33488] - Staining of human tonsil shows low expression as expected.
Immunohistochemistry-Paraffin: HGD Antibody [NBP2-33488] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: HGD Antibody [NBP2-33488] - Staining in human liver and tonsil tissues using anti-HGD antibody. Corresponding HGD RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HGD Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: QVPGGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVLTAKSVRPGVAIADFVIFPP
Specificity
Specificity of human HGD antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HGD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HGD Protein (NBP2-33488PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HGD Antibody

  • AKU
  • EC 1.13.11.5
  • HGOFLJ94126
  • homogentisate 1,2-dioxygenase (homogentisate oxidase)
  • homogentisate 1,2-dioxygenase
  • homogentisate oxidase
  • Homogentisate oxygenase
  • Homogentisic acid oxidase
  • homogentisicase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-89366
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-47476
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-65021
Species: Hu
NBP1-87349
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88036
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NBP2-66139
Species: Hu
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-48736
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB100-64650
Species: Hu, Mu, Rt, Po, GP, Ze
Applications: IHC, IHC-Fr, IHC-P
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-48736
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33488
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HGD Antibody (NBP2-33488) (0)

There are no publications for HGD Antibody (NBP2-33488).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HGD Antibody (NBP2-33488) (0)

There are no reviews for HGD Antibody (NBP2-33488). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HGD Antibody (NBP2-33488) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for HGD Antibody (NBP2-33488)

Discover related pathways, diseases and genes to HGD Antibody (NBP2-33488). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HGD Antibody (NBP2-33488)

Discover more about diseases related to HGD Antibody (NBP2-33488).
 

Pathways for HGD Antibody (NBP2-33488)

View related products by pathway.

PTMs for HGD Antibody (NBP2-33488)

Learn more about PTMs related to HGD Antibody (NBP2-33488).

Blogs on HGD

There are no specific blogs for HGD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HGD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HGD
Uniprot