HFE Antibody

Images

 
Western Blot: HFE Antibody [NBP1-59054] - Hela cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit

Order Details

HFE Antibody Summary

Immunogen
Synthetic peptides corresponding to HFE (hemochromatosis) The peptide sequence was selected from the N terminal of HFE. Peptide sequence MGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMW.
Clonality
Polyclonal
Host
Rabbit
Gene
HFE
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against HFE and was validated on Western blot.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HFE Antibody

  • dJ221C16.10.1
  • hemochromatosis
  • hereditary hemochromatosis protein HLA-H
  • hereditary hemochromatosis protein
  • HH
  • high Fe
  • HLAH
  • HLA-HHFE1
  • MGC103790
  • MHC class I-like protein HFE
  • MVCD7

Background

HFE is a membrane protein that is similar to MHC class I-type proteins and associates with beta2-microglobulin (beta2M). It is thought that this protein functions to regulate iron absorption by regulating the interaction of the transferrin receptor with transferrin. The iron storage disorder, hereditary haemochromatosis, is a recessive genetic disorder that results from defects in its gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NBP1-71662
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP2-13356
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
MAB3120
Species: Hu
Applications: WB, Simple Western
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
NB600-874
Species: Hu, Pm
Applications: WB, ELISA, IHC, IHC-P, Flow-IC
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-33711
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-59054
Species: Hu
Applications: WB

Publications for HFE Antibody (NBP1-59054) (0)

There are no publications for HFE Antibody (NBP1-59054).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HFE Antibody (NBP1-59054) (0)

There are no reviews for HFE Antibody (NBP1-59054). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HFE Antibody (NBP1-59054) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HFE Antibody Products

Related Products by Gene

Bioinformatics Tool for HFE Antibody (NBP1-59054)

Discover related pathways, diseases and genes to HFE Antibody (NBP1-59054). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HFE Antibody (NBP1-59054)

Discover more about diseases related to HFE Antibody (NBP1-59054).
 

Pathways for HFE Antibody (NBP1-59054)

View related products by pathway.

PTMs for HFE Antibody (NBP1-59054)

Learn more about PTMs related to HFE Antibody (NBP1-59054).

Blogs on HFE.

The role of Smoothened in pulmonary pathologies
The Hedgehog (Hh) family of secreted proteins is involved in a number of developmental processes, one of which is the development of cancer. Past data suggests that the Sonic hedgehog (Shh) receptor is composed of two transmembrane proteins, Patche...  Read full blog post.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol HFE
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-59054 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought