HFE Antibody


Western Blot: HFE Antibody [NBP1-59054] - Hela cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

HFE Antibody Summary

Synthetic peptides corresponding to HFE (hemochromatosis) The peptide sequence was selected from the N terminal of HFE. Peptide sequence MGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMW.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against HFE and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HFE Antibody

  • dJ221C16.10.1
  • hemochromatosis
  • hereditary hemochromatosis protein HLA-H
  • hereditary hemochromatosis protein
  • HH
  • high Fe
  • HLAH
  • MGC103790
  • MHC class I-like protein HFE
  • MVCD7


HFE is a membrane protein that is similar to MHC class I-type proteins and associates with beta2-microglobulin (beta2M). It is thought that this protein functions to regulate iron absorption by regulating the interaction of the transferrin receptor with transferrin. The iron storage disorder, hereditary haemochromatosis, is a recessive genetic disorder that results from defects in its gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB, Simple Western
Species: Hu, Mu
Applications: WB, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Mu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P

Publications for HFE Antibody (NBP1-59054) (0)

There are no publications for HFE Antibody (NBP1-59054).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HFE Antibody (NBP1-59054) (0)

There are no reviews for HFE Antibody (NBP1-59054). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HFE Antibody (NBP1-59054) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional HFE Antibody Products

Related Products by Gene

Bioinformatics Tool for HFE Antibody (NBP1-59054)

Discover related pathways, diseases and genes to HFE Antibody (NBP1-59054). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HFE Antibody (NBP1-59054)

Discover more about diseases related to HFE Antibody (NBP1-59054).

Pathways for HFE Antibody (NBP1-59054)

View related products by pathway.

PTMs for HFE Antibody (NBP1-59054)

Learn more about PTMs related to HFE Antibody (NBP1-59054).

Blogs on HFE.

The role of Smoothened in pulmonary pathologies
The Hedgehog (Hh) family of secreted proteins is involved in a number of developmental processes, one of which is the development of cancer. Past data suggests that the Sonic hedgehog (Shh) receptor is composed of two transmembrane proteins, Patche...  Read full blog post.

Contact Information

Product PDFs

Review this Product

Be the first to review our HFE Antibody and receive a gift card or discount.


Gene Symbol HFE

Customers Who Bought This Also Bought