HEXO Recombinant Protein Antigen

Images

 
There are currently no images for HEXO Protein (NBP2-38782PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HEXO Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ERI1.

Source: E. coli

Amino Acid Sequence: ELRAKLSEFKLETRGVKDVLKKRLKNYYKKQKLMLKESNFADSYYDYICIIDFEATCEE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ERI1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38782.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HEXO Recombinant Protein Antigen

  • 3' exoribonuclease
  • 3'-5' exonuclease ERI1
  • 3'EXO
  • 3'HEXO
  • EC 3.1
  • enhanced RNAi three prime mRNA exonuclease homolog 1
  • Eri-1 homolog
  • exoribonuclease 1
  • HEXO
  • histone mRNA 3' end-specific exonuclease
  • Histone mRNA 3'-end-specific exoribonuclease
  • Histone mRNA 3'-exonuclease 1
  • MGC35395
  • Protein 3'hExo
  • THEX1
  • three prime histone mRNA exonuclease 1,3'-5' exoribonuclease 1
  • three prime mRNA exonuclease 1

Background

HEXO is a 50-kD protein containing a SAP domain capable of recognizing AT-rich scaffold-attachment regions (SARs) in chromosomal DNA, and a exonuclease domain similar to those of DEDD exonuclease family members. HEXO is an RNA exonuclease that binds to the 3' end of histone mRNAs and probably degrades them, suggesting that it plays an essential role in histone mRNA decay after replication. It is also able to degrade the 3' overhangs of short interfering RNAs (siRNAs) in vitro, suggesting a possible role as a regulator of RNA interference (RNAi).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46321
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB500-191
Species: Hu, Mu
Applications: IP, WB
H00022894-B01P
Species: Ch, Hu, Mu
Applications: ICC/IF, WB
AF2156
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP3-05500
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87404
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP1-47778
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
H00004068-M01
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
NBP2-94458
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
NBP1-85630
Species: Hu
Applications: IHC, IHC-P, WB
H00023316-M03
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, WB
NBP1-82170
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-21367
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB120-6125
Species: Bv, Ca, Dr(-), Hu, Mu(-), Pm, Xp
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IP, MiAr, WB

Publications for HEXO Protein (NBP2-38782PEP) (0)

There are no publications for HEXO Protein (NBP2-38782PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HEXO Protein (NBP2-38782PEP) (0)

There are no reviews for HEXO Protein (NBP2-38782PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HEXO Protein (NBP2-38782PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HEXO Products

Blogs on HEXO

There are no specific blogs for HEXO, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HEXO Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ERI1