HEXO Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

HEXO Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ERI1.
  
  

  Source: E.coli

  Amino Acid Sequence: ELRAKLSEFKLETRGVKDVLKKRLKNYYKKQKLMLKESNFADSYYDYICIIDFEATCEE

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: ERI1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This peptide is useful as a blocking peptide for NBP2-38782.
  Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.
  
  For further blocking peptide related information and a protocol, click here.
• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for HEXO Recombinant Protein Antigen

• 3' exoribonuclease
• 3'-5' exonuclease ERI1
• 3'EXO
• 3'HEXO
• EC 3.1
• enhanced RNAi three prime mRNA exonuclease homolog 1
• Eri-1 homolog
• exoribonuclease 1
• HEXO
• histone mRNA 3' end-specific exonuclease
• Histone mRNA 3'-end-specific exoribonuclease
• Histone mRNA 3'-exonuclease 1
• MGC35395
• Protein 3'hExo
• THEX1
• three prime histone mRNA exonuclease 1,3'-5' exoribonuclease 1
• three prime mRNA exonuclease 1

Background

HEXO is a 50-kD protein containing a SAP domain capable of recognizing AT-rich scaffold-attachment regions (SARs) in chromosomal DNA, and a exonuclease domain similar to those of DEDD exonuclease family members. HEXO is an RNA exonuclease that binds to the 3' end of histone mRNAs and probably degrades them, suggesting that it plays an essential role in histone mRNA decay after replication. It is also able to degrade the 3' overhangs of short interfering RNAs (siRNAs) in vitro, suggesting a possible role as a regulator of RNA interference (RNAi).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ERI1