HEXB Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HEXB. Source: E. coli
Amino Acid Sequence: FGFYKWHHEPAEFQAKTQVQQLLVSITLQSECDAFPNISSDESYTLLVKEPVAVLKANRVW Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
HEXB |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49211. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
25 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for HEXB Recombinant Protein Antigen
Background
HEXB, also known as Beta-hexosaminidase subunit beta, is a 556 amino acid that is 63 kDa, lysosome located, composed of two subunits, alpha and beta, which are encoded by separate gene, and in control of the degradation of GM2 gangliosides and other molecules containing terminal N-acetyl hexosamines, in the brain and other tissues. Current research is being performed on several diseases and disorders including gangliosidosis, sandhoff disease, infantile, juvenile, and adult forms, tay-sachs disease, neuronitis, lysosomal storage disease, motor neuron disease, cervical cancer, mucopolysaccharidosis, cervicitis, neurodegenerative disease, recurrent respiratory papillomatosis, hairy cell leukemia, macrocephaly, autonomic dysfunction, cholesteatoma, type 2 diabetes mellitus, rheumatoid arthritis, and diarrhea. The protein has been linked to pathways such as glycan degradation, amino sugar and nucleotide sugar metabolism, glycosaminoglycan degradation, glycosphingolipid biosynthesis - globo series, glycosphingolipid biosynthesis - ganglio series, MPS VI - Maroteaux-Lamy syndrome, metabolic pathways, and lysosome pathways where it interacts with EIF2D, GYG1, CSNK2B, CHIA,CHIT1, and CHIT1 proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IP, WB
Publications for HEXB Recombinant Protein Antigen (NBP2-49211PEP) (0)
There are no publications for HEXB Recombinant Protein Antigen (NBP2-49211PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HEXB Recombinant Protein Antigen (NBP2-49211PEP) (0)
There are no reviews for HEXB Recombinant Protein Antigen (NBP2-49211PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for HEXB Recombinant Protein Antigen (NBP2-49211PEP) (0)
Additional HEXB Products
Research Areas for HEXB Recombinant Protein Antigen (NBP2-49211PEP)
Find related products by research area.
|
Blogs on HEXB