![Western Blot: HES6 Antibody [NBP2-87564] - WB Suggested Anti-Hes6 Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Stomach](http://images.novusbio.com/fullsize/HES6-Antibody-Western-Blot-NBP2-87564-img0001.jpg "Western Blot: HES6 Antibody [NBP2-87564] - WB Suggested Anti-Hes6 Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Stomach")
| Reactivity | MuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Description | Novus Biologicals Rabbit HES6 Antibody - BSA Free (NBP2-87564) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Mouse HES6. Peptide sequence: LLAGTEVQAKLENAEVLELTVRRVQGALRGRAREREQLQAEASERFAAGY The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | HES6 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Immunocytochemistry HES-4 Antibody [Unconjugated]](https://images.novusbio.com/images2/HES4_AF3600_Immunocytochemistry__Immunofluorescence_19235.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for HES6 Antibody (NBP2-87564)Find related products by research area.
|
|
Using the Hif-1 Alpha Antibody in Prostate Cancer Research The Hypoxia-inducible Factor 1 (HIF1) protein is a heterodimeric transcription factor which plays an important role in mammalian oxygen homeostasis in conditions of hypoxia, or low oxygen concentration. HIF-1 alpha antibody reagents are widely used in... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | HES6 |
![Immunohistochemistry ASCL1/Mash1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2567_mouse-ascl1-mash1-affinity-purified-polyclonal-ab-immunohistochemistry-1732021122114.jpg)
![Chromatin Immunoprecipitation (ChIP) HNF-3 beta/FoxA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/HNF-3_beta_AF2400_Chromatin_Immunoprecipitation_11227.jpg)
![Immunocytochemistry HNF-3 beta/FoxA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/HNF-3_beta_AF2400_Immunocytochemistry_6484.jpg)
![Immunohistochemistry HNF-3 beta/FoxA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/HNF3_beta_AF2400_Immunohistochemistry_23167.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
