Recombinant Human Heparan Sulfate Proteoglycan 2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Heparan Sulfate Proteoglycan 2 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 25 - 134 of Human HSPG2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GLRAYDGLSLPEDIETVTASQMRWTHSYLSDDEDMLADSISGDDLGSGDLGSGDFQMVYFRALVNFTRSIEYSPQLEDAGSREFREVSEAVVDTLESEYLKIPGDQVVSV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
HSPG2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Heparan Sulfate Proteoglycan 2 Protein

  • basement membrane-specific heparan sulfate proteoglycan core protein
  • endorepellin (domain V region)
  • heparan sulfate proteoglycan 2
  • HSPG
  • perlecan proteoglycan
  • perlecan
  • PLCSchwartz-Jampel syndrome 1 (chondrodystrophic myotonia)
  • PRCAN
  • SJA
  • SJS
  • SJS1

Background

Heparan sulfate proteoglycan is a major component of basement membranes, where the molecule may be involved in the stabilization of other molecules as well as being involved with glomerular permeability to macromolecules and cell adhesion. This form of HSPG, known as HSPG2 or perlecan, is encoded by a gene that maps to chromosome 1. The gene for the form of HSPG associated with the cell surface of fibroblasts has been mapped to human chromosome 8 (MIM 142460).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB5018
Species: Hu
Applications: WB, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-52532
Species: Hu, Rt, Mk
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
AF4466
Species: Hu, Mu
Applications: WB
AF4925
Species: Mu
Applications: WB, Simple Western, IHC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-81586
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC

Publications for Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01) (0)

There are no publications for Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01) (0)

There are no reviews for Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Heparan Sulfate Proteoglycan 2 Products

Bioinformatics Tool for Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01)

Discover related pathways, diseases and genes to Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01)

Discover more about diseases related to Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01).
 

Pathways for Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01)

View related products by pathway.

PTMs for Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01)

Learn more about PTMs related to Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01).

Blogs on Heparan Sulfate Proteoglycan 2

There are no specific blogs for Heparan Sulfate Proteoglycan 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Heparan Sulfate Proteoglycan 2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HSPG2