Recombinant Human Heparan Sulfate Proteoglycan 2 GST (N-Term) Protein

Images

 
Recombinant Human Heparan Sulfate Proteoglycan 2 Protein [H00003339-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Heparan Sulfate Proteoglycan 2 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 25-134 of Human Heparan Sulfate Proteoglycan 2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: GLRAYDGLSLPEDIETVTASQMRWTHSYLSDDEDMLADSISGDDLGSGDLGSGDFQMVYFRALVNFTRSIEYSPQLEDAGSREFREVSEAVVDTLESEYLKIPGDQVVSV

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
HSPG2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Heparan Sulfate Proteoglycan 2 GST (N-Term) Protein

  • basement membrane-specific heparan sulfate proteoglycan core protein
  • endorepellin (domain V region)
  • heparan sulfate proteoglycan 2
  • HSPG
  • perlecan proteoglycan
  • perlecan
  • PLCSchwartz-Jampel syndrome 1 (chondrodystrophic myotonia)
  • PRCAN
  • SJA
  • SJS
  • SJS1

Background

Heparan sulfate proteoglycan is a major component of basement membranes, where the molecule may be involved in the stabilization of other molecules as well as being involved with glomerular permeability to macromolecules and cell adhesion. This form of HSPG, known as HSPG2 or perlecan, is encoded by a gene that maps to chromosome 1. The gene for the form of HSPG associated with the cell surface of fibroblasts has been mapped to human chromosome 8 (MIM 142460).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
MAB5018
Species: Hu
Applications: IP, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-47842
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-52532
Species: Hu, Pm, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
233-FB/CF
Species: Hu
Applications: BA
AF6868
Species: Hu
Applications: IHC, KO, WB
236-EG
Species: Hu
Applications: BA
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
AF4466
Species: Hu, Mu
Applications: WB
210-TA
Species: Hu
Applications: BA
AF4925
Species: Mu
Applications: IHC, Simple Western, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
H00008398-D01P
Species: Hu, Mu
Applications: WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
H00151056-B01P
Species: Hu, Mu
Applications: WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
H00003339-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01) (0)

There are no publications for Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01) (0)

There are no reviews for Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01). (Showing 1 - 1 of 1 FAQ).

  1. Is the item expressed in E.coli or from any other bacterial expressed system?
    • The protein H00003339-Q01 was manufactured by Abnova in their cell free wheat germ system. Novus Biologicals is a distributor for their products in the US. Additional information on this expression system can be seen here: http://www.abnova.com/support/technologies.asp?switchfunctionid={539614B1-7CBB-4068-A93B-1B44DC6F2801}.

Additional Heparan Sulfate Proteoglycan 2 Products

Bioinformatics Tool for Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01)

Discover related pathways, diseases and genes to Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01)

Discover more about diseases related to Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01).
 

Pathways for Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01)

View related products by pathway.

PTMs for Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01)

Learn more about PTMs related to Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01).
 

Research Areas for Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01)

Find related products by research area.

Blogs on Heparan Sulfate Proteoglycan 2

There are no specific blogs for Heparan Sulfate Proteoglycan 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Heparan Sulfate Proteoglycan 2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HSPG2