Recombinant Human Heparan Sulfate Proteoglycan 2 GST (N-Term) Protein Summary
Description |
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 25-134 of Human Heparan Sulfate Proteoglycan 2 Source: Wheat Germ (in vitro) Amino Acid Sequence: GLRAYDGLSLPEDIETVTASQMRWTHSYLSDDEDMLADSISGDDLGSGDLGSGDFQMVYFRALVNFTRSIEYSPQLEDAGSREFREVSEAVVDTLESEYLKIPGDQVVSV |
Preparation Method |
in vitro wheat germ expression system |
Details of Functionality |
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
Source |
Wheat germ |
Protein/Peptide Type |
Partial Recombinant Protein |
Gene |
HSPG2 |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- Western Blot
|
Theoretical MW |
37.84 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -80C. Avoid freeze-thaw cycles. |
Buffer |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human Heparan Sulfate Proteoglycan 2 GST (N-Term) Protein
Background
Heparan sulfate proteoglycan is a major component of basement membranes, where the molecule may be involved in the stabilization of other molecules as well as being involved with glomerular permeability to macromolecules and cell adhesion. This form of HSPG, known as HSPG2 or perlecan, is encoded by a gene that maps to chromosome 1. The gene for the form of HSPG associated with the cell surface of fibroblasts has been mapped to human chromosome 8 (MIM 142460).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rb(-)
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IP, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Pm, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, KO, WB
Species: Hu
Applications: BA
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: BA
Species: Mu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu, Mu
Applications: WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: WB, ELISA, PA, AP
Publications for Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01) (0)
There are no publications for Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01) (0)
There are no reviews for Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01). (Showing 1 - 1 of 1 FAQ).
-
Is the item expressed in E.coli or from any other bacterial expressed system?
- The protein H00003339-Q01 was manufactured by Abnova in their cell free wheat germ system. Novus Biologicals is a distributor for their products in the US. Additional information on this expression system can be seen here: http://www.abnova.com/support/technologies.asp?switchfunctionid={539614B1-7CBB-4068-A93B-1B44DC6F2801}.
Additional Heparan Sulfate Proteoglycan 2 Products
Bioinformatics Tool for Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01)
Discover related pathways, diseases and genes to Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01)
Discover more about diseases related to Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01).
| | Pathways for Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01)
View related products by pathway.
|
PTMs for Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01)
Learn more about PTMs related to Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01).
| | Research Areas for Heparan Sulfate Proteoglycan 2 Partial Recombinant Protein (H00003339-Q01)
Find related products by research area.
|
Blogs on Heparan Sulfate Proteoglycan 2