Hemoglobin beta Antibody (7B24) - Azide and BSA Free Summary
Immunogen |
HBB (AAH07075, 38 a.a. ~ 147 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALPHKYH |
Isotype |
IgG1 Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
HBB |
Purity |
Protein A or G purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
Protein A or G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Hemoglobin beta Antibody (7B24) - Azide and BSA Free
Background
The alpha (HBA) and beta (HBB) loci determine the structure of the 2 types of polypeptide chains in adult hemoglobin, Hb A. The normal adult hemoglobin tetramer consists of two alpha chains and two beta chains. Mutant beta globin causes sickle cell anemia. Absence of beta chain causes beta-zero-thalassemia. Reduced amounts of detectable beta globin causes beta-plus-thalassemia. The order of the genes in the beta-globin cluster is 5'-epsilon -- gamma-G -- gamma-A -- delta -- beta--3'.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: ChIP, ELISA, ICC/IF, WB
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB, ELISA
Publications for Hemoglobin beta Antibody (H00003043-M12-100ug) (0)
There are no publications for Hemoglobin beta Antibody (H00003043-M12-100ug).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Hemoglobin beta Antibody (H00003043-M12-100ug) (0)
There are no reviews for Hemoglobin beta Antibody (H00003043-M12-100ug).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Hemoglobin beta Antibody (H00003043-M12-100ug). (Showing 1 - 1 of 1 FAQ).
-
What are the concentrations of H00003043M02, H00003043M12 and NBP2-32769. Also, do these antibodies detect glycosylated hemoglobin specifically.
- For both H00003043M02 and H00003043M12 have the concentration of 1.0 mg/ml. H00003043M02 and H00003043M12 have not been verified for the purpose of detecting glycosylated hemoglobin.If you look for antibodies specifically for detection of glycosylated hemoglobin, I’ll recommend the followings:MAB0030-M06 Human HbA1c monoclonal antibody, clone 1D3MAB0030-M06A Human HbA1c monoclonal antibody, clone 1D3MAB0030-M01 Human HbA1c monoclonal antibody, clone 1E4MAB0030-M03 Human HbA1c monoclonal antibody, clone 2A10MAB0030-M05 Human HbA1c monoclonal antibody, clone 2A3MAB0030-M02 Human HbA1c monoclonal antibody, clone 2H5MAB0030-M04 Human HbA1c monoclonal antibody, clone 4B10MAB0030-M07 Human HbA1c monoclonal antibody, clone 7E2For NBP2-32769, the concentration is 6.3 mg/ml for the current lot and it reacts with glycated hemoglobin and it does not cross-react with non-glycated hemoglobin.
Secondary Antibodies
| |
Isotype Controls
|
Additional Hemoglobin beta Products
Array H00003043-M12-100ug
Blogs on Hemoglobin beta