HECTD2 Antibody - BSA Free

Immunohistochemistry-Paraffin: HECTD2 Antibody [NBP1-83481] - Staining of human Rectum shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: HECTD2 Antibody [NBP1-83481] - Staining of human Placenta shows strong cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: HECTD2 Antibody [NBP1-83481] - Staining of human Prostate shows strong cytoplasmic positivity in smooth muscle and glandular cells.

Immunohistochemistry-Paraffin: HECTD2 Antibody [NBP1-83481] - Staining of human Testis shows strong cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.

Analysis in human cell line RH-30.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HECTD2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SPAHLVFPNIKNVREPPPICLDVRQKQRTSMDASSSEMKAPVLPEPILPIQPKTVKDFQEDVEKVKSSGDWKA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HECTD2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  HECTD2 Protein (NBP1-83481PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HECTD2 Antibody - BSA Free

• EC 6.3.2.-
• EC2.3.2.26
• FLJ16050
• FLJ37306
• HECT domain containing 2
• HECT domain-containing protein 2
• HECTD2
• probable E3 ubiquitin-protein ligase HECTD2

Background

Probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in theform of a thioester and then directly transfers the ubiquitin to targeted substrates

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HECTD2