HE4/WFDC2 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
WFDC2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. WB and ICC are not recommended applications for this product. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for HE4/WFDC2 Antibody - BSA Free
Background
The HE4 gene encodes a protein that is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: Bind
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, KO
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Pm-Cm, Hu, RM
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vivo, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Hu
Applications: ELISA
Publications for HE4/WFDC2 Antibody (NBP2-48762) (0)
There are no publications for HE4/WFDC2 Antibody (NBP2-48762).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HE4/WFDC2 Antibody (NBP2-48762) (0)
There are no reviews for HE4/WFDC2 Antibody (NBP2-48762).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for HE4/WFDC2 Antibody (NBP2-48762). (Showing 1 - 1 of 1 FAQ).
-
I would like to build a sandwich ELISA for detection of HE4 levels in human blood. I found there are several HE4 antibodies from your company. Could you please provide me some information among these products, which two antibodies will work well with the HE4 antigen in a sandwich ELISA pair?
- At this time we have not tested any of our HE4 antibodies for use in a Sandwich ELISA. As such, we cannot say with certainty, which will work together as an effective pair. Often times in our experience, choosing a monoclonal antibody for capture, and a polyclonal antibody for detection will yield great results. If you plan on testing any of our HE4 antibodies for use in a Sandwich ELISA then we would encourage you to apply for our Innovators Reward Program. Under the terms of this program, you will be eligible for a full credit in exchange for your data, in the form of an online review, regardless of positive or negative results. Additional Innovator’s Reward information can be found at the following here
Secondary Antibodies
| |
Isotype Controls
|
Additional HE4/WFDC2 Products
Research Areas for HE4/WFDC2 Antibody (NBP2-48762)
Find related products by research area.
|
Blogs on HE4/WFDC2