HDGF Antibody (2D6) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: HDGF Antibody (2D6) [H00003068-M09] - Analysis of monoclonal antibody to HDGF on HeLa cell. Antibody concentration 10 ug/ml

ELISA: HDGF Antibody (2D6) [H00003068-M09] - Detection limit for recombinant GST tagged HDGF is approximately 3ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 2D6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

HDGF Antibody (2D6) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: HDGF (NP_004485, 184 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TLEVERPLPMEVEKNSTPSEPGSGRGPPQEEEEEEDEEEEATKEDAEAPGIRDHESL
• Specificity: HDGF - hepatoma-derived growth factor (high-mobility group protein 1-like) (2D6)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: HDGF
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactivity against recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HDGF Antibody (2D6) - Azide and BSA Free

• FLJ96580
• HDGF
• hepatoma-derived growth factor (high-mobility group protein 1-like)
• hepatoma-derived growth factor
• High mobility group protein 1-like 2
• HMG-1L2
• HMG1L2DKFZp686J1764
• HuHGF

Background

This gene encodes a member of the hepatoma-derived growth factor family. The encoded protein has mitogenic and DNA-binding activity and may play a role in cellular proliferation and differentiation. This gene was thought initially to be located on chromosome X, however, that location has been determined to correspond to a related pseudogene. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HDGF
• Entrez:
  • 3068(Human)
• Uniprot:
  • NP_004485(Human)